Nyctereutes procyonoides (raccoon dog): 129494739 Help Entry 129494739         CDS       T09008                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04060   Cytokine-cytokine receptor interaction npo04151   PI3K-Akt signaling pathway npo04217   Necroptosis npo04380   Osteoclast differentiation npo04620   Toll-like receptor signaling pathway npo04621   NOD-like receptor signaling pathway npo04622   RIG-I-like receptor signaling pathway npo04623   Cytosolic DNA-sensing pathway npo04630   JAK-STAT signaling pathway npo04650   Natural killer cell mediated cytotoxicity npo04668   TNF signaling pathway npo04936   Alcoholic liver disease npo05135   Yersinia infection npo05142   Chagas disease npo05152   Tuberculosis npo05160   Hepatitis C npo05161   Hepatitis B npo05162   Measles npo05163   Human cytomegalovirus infection npo05164   Influenza A npo05165   Human papillomavirus infection npo05167   Kaposi sarcoma-associated herpesvirus infection npo05168   Herpes simplex virus 1 infection npo05169   Epstein-Barr virus infection npo05170   Human immunodeficiency virus 1 infection npo05171   Coronavirus disease - COVID-19 npo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     129494739 (IFNB1)    04668 TNF signaling pathway     129494739 (IFNB1)    04151 PI3K-Akt signaling pathway     129494739 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129494739 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     129494739 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129494739 (IFNB1)    04621 NOD-like receptor signaling pathway     129494739 (IFNB1)    04622 RIG-I-like receptor signaling pathway     129494739 (IFNB1)    04623 Cytosolic DNA-sensing pathway     129494739 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     129494739 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     129494739 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     129494739 (IFNB1)    05161 Hepatitis B     129494739 (IFNB1)    05160 Hepatitis C     129494739 (IFNB1)    05171 Coronavirus disease - COVID-19     129494739 (IFNB1)    05164 Influenza A     129494739 (IFNB1)    05162 Measles     129494739 (IFNB1)    05168 Herpes simplex virus 1 infection     129494739 (IFNB1)    05163 Human cytomegalovirus infection     129494739 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     129494739 (IFNB1)    05169 Epstein-Barr virus infection     129494739 (IFNB1)    05165 Human papillomavirus infection     129494739 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     129494739 (IFNB1)    05152 Tuberculosis     129494739 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     129494739 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129494739 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     129494739 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:npo04052]     129494739 (IFNB1) Cytokines and neuropeptides [BR:npo04052]  Cytokines   Interferons    129494739 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  129494739 NCBI-ProteinID:  XP_055157704 LinkDB All DBs Position Unknown AA seq 186 aa AA seqDB search MTGRCILQTTLLLYFSTMALAMSNDLLRSQLSSSSLECQELLLQLNGTTEYCLKDRINFE IPEEIEKSRQFQKEDIILITHEMFQKIFDIFRRDISRTGWNETTVENLLVKLHGQKEHLE IILEDVIEKENFTWDNRTLLHLKKYYLRIVQYLKAKEYSICAWTIVRAEICRNFFFLNIL TDYLQN NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccggtcgatgcatcctccaaacaactctcctgctgtatttctccaccatggctctt gccatgagcaacgacttgcttcgatcccaactaagcagcagcagtttggagtgtcaggag ctcctattacagttgaatggaaccactgaatattgcctcaaggacaggataaacttcgag atccctgaggaaatcgagaaatcacgccagttccagaaggaggacatcatattgatcacc catgagatgttccagaagatctttgatattttcaggagagacatctctagaacaggatgg aatgagaccactgtcgagaaccttcttgtgaagctccacgggcagaaggaacatctggag ataatcctggaggacgtcatagagaaggaaaacttcacctgggacaacaggactcttctg cacctgaagaaatattacttaaggattgtgcagtacctgaaggccaaggaatacagcatc tgtgcctggacaatagtccgagcagaaatctgcaggaactttttcttccttaatatactt acagattatctccagaactga

DBGET integrated database retrieval system