Nyctereutes procyonoides (raccoon dog): 129496401 Help Entry 129496401         CDS       T09008                                  Symbol FOS Name (RefSeq) protein c-Fos   KO K04379   proto-oncogene protein c-fos Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo01522   Endocrine resistance npo04010   MAPK signaling pathway npo04024   cAMP signaling pathway npo04210   Apoptosis npo04380   Osteoclast differentiation npo04620   Toll-like receptor signaling pathway npo04657   IL-17 signaling pathway npo04658   Th1 and Th2 cell differentiation npo04659   Th17 cell differentiation npo04660   T cell receptor signaling pathway npo04662   B cell receptor signaling pathway npo04668   TNF signaling pathway npo04713   Circadian entrainment npo04725   Cholinergic synapse npo04728   Dopaminergic synapse npo04915   Estrogen signaling pathway npo04917   Prolactin signaling pathway npo04921   Oxytocin signaling pathway npo04926   Relaxin signaling pathway npo04928   Parathyroid hormone synthesis, secretion and action npo04932   Non-alcoholic fatty liver disease npo04935   Growth hormone synthesis, secretion and action npo05031   Amphetamine addiction npo05132   Salmonella infection npo05133   Pertussis npo05135   Yersinia infection npo05140   Leishmaniasis npo05142   Chagas disease npo05161   Hepatitis B npo05162   Measles npo05166   Human T-cell leukemia virus 1 infection npo05167   Kaposi sarcoma-associated herpesvirus infection npo05170   Human immunodeficiency virus 1 infection npo05171   Coronavirus disease - COVID-19 npo05200   Pathways in cancer npo05207   Chemical carcinogenesis - receptor activation npo05208   Chemical carcinogenesis - reactive oxygen species npo05210   Colorectal cancer npo05224   Breast cancer npo05231   Choline metabolism in cancer npo05235   PD-L1 expression and PD-1 checkpoint pathway in cancer npo05323   Rheumatoid arthritis npo05417   Lipid and atherosclerosis npo05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129496401 (FOS)    04668 TNF signaling pathway     129496401 (FOS)    04024 cAMP signaling pathway     129496401 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     129496401 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129496401 (FOS)    04660 T cell receptor signaling pathway     129496401 (FOS)    04658 Th1 and Th2 cell differentiation     129496401 (FOS)    04659 Th17 cell differentiation     129496401 (FOS)    04657 IL-17 signaling pathway     129496401 (FOS)    04662 B cell receptor signaling pathway     129496401 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     129496401 (FOS)    04917 Prolactin signaling pathway     129496401 (FOS)    04921 Oxytocin signaling pathway     129496401 (FOS)    04926 Relaxin signaling pathway     129496401 (FOS)    04935 Growth hormone synthesis, secretion and action     129496401 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     129496401 (FOS)   09156 Nervous system    04725 Cholinergic synapse     129496401 (FOS)    04728 Dopaminergic synapse     129496401 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     129496401 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     129496401 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129496401 (FOS)    05207 Chemical carcinogenesis - receptor activation     129496401 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     129496401 (FOS)    05231 Choline metabolism in cancer     129496401 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     129496401 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     129496401 (FOS)    05224 Breast cancer     129496401 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     129496401 (FOS)    05170 Human immunodeficiency virus 1 infection     129496401 (FOS)    05161 Hepatitis B     129496401 (FOS)    05171 Coronavirus disease - COVID-19     129496401 (FOS)    05162 Measles     129496401 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     129496401 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     129496401 (FOS)    05135 Yersinia infection     129496401 (FOS)    05133 Pertussis     129496401 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     129496401 (FOS)    05142 Chagas disease     129496401 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     129496401 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     129496401 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129496401 (FOS)    05418 Fluid shear stress and atherosclerosis     129496401 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     129496401 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     129496401 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:npo03000]     129496401 (FOS)    04131 Membrane trafficking [BR:npo04131]     129496401 (FOS) Transcription factors [BR:npo03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     129496401 (FOS) Membrane trafficking [BR:npo04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     129496401 (FOS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 CCDC110 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  129496401 NCBI-ProteinID:  XP_055160518 LinkDB All DBs Position Unknown AA seq 380 aa AA seqDB search MMFPGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVVKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT LPLLNDPEPKPSVEPVKGIGSMELKAEPFDDFLFPASSRPGGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATEPEPLCTPIVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttccctggtttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcg tccccggccggggacagcctctcctactaccactccccggccgactccttctccagcatg ggctctcccgtcaacgcgcaggacttctgcaccgatctggccgtctccagtgccaacttt atcccgacggtgactgccatctccaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctccgtggccccgtcccagaccagagccccccacccgtatggagtccccacc ccctcggctggggcttactccagggctggcgttgtgaagaccatgacgggaggcagagct cagagcattggccggaggggcaaggtggaacagctgtccccagaagaagaagagaaaagg agaatccgaagggaaaggaataagatggctgcagccaagtgccggaaccgcaggagggag ctgactgacacgctccaagcggagacagaccaactggaagacgagaagtctgctctgcag accgagattgccaacctgctgaaggagaaggagaaactagagttcatcctggcagctcac cgacctgcctgcaagatccctgatgacctgggcttccccgaagagatgtccgtggcttcc ctagatctgagcgggggcctgcccgaggccgccaccccggagtccgaggaggctttcacc ctgcccctcctcaatgatcctgagcccaagccctccgtggagcccgtcaagggcatcggc agcatggagctgaaggccgagccctttgatgacttcctgtttccagcatcatccagaccc ggcggctcggagaccgcccgctccgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagagccc gagcctctgtgcacccccatagtcacctgtactcctagctgcactacctacacgtcttcc ttcgtcttcacctaccctgaggctgactccttccccagctgtgcggccgctcatcgcaag ggcagcagcagcaacgaaccctcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system