Nyctereutes procyonoides (raccoon dog): 129511430 Help Entry 129511430         CDS       T09008                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04010   MAPK signaling pathway npo04014   Ras signaling pathway npo04015   Rap1 signaling pathway npo04024   cAMP signaling pathway npo04062   Chemokine signaling pathway npo04510   Focal adhesion npo04517   IgSF CAM signaling npo04520   Adherens junction npo04611   Platelet activation npo04670   Leukocyte transendothelial migration npo04720   Long-term potentiation npo04722   Neurotrophin signaling pathway npo04934   Cushing syndrome npo04972   Pancreatic secretion npo05211   Renal cell carcinoma npo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129511430 (RAP1B)    04014 Ras signaling pathway     129511430 (RAP1B)    04015 Rap1 signaling pathway     129511430 (RAP1B)    04024 cAMP signaling pathway     129511430 (RAP1B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     129511430 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     129511430 (RAP1B)    04520 Adherens junction     129511430 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     129511430 (RAP1B)    04670 Leukocyte transendothelial migration     129511430 (RAP1B)    04062 Chemokine signaling pathway     129511430 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     129511430 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     129511430 (RAP1B)    04722 Neurotrophin signaling pathway     129511430 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     129511430 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129511430 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     129511430 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npo04147]     129511430 (RAP1B)    04031 GTP-binding proteins [BR:npo04031]     129511430 (RAP1B) Exosome [BR:npo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129511430 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    129511430 (RAP1B)   Exosomal proteins of colorectal cancer cells    129511430 (RAP1B) GTP-binding proteins [BR:npo04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     129511430 (RAP1B) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  129511430 NCBI-ProteinID:  XP_055184047 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttaccgcaatgagggatttatacatgaaaaatggacaaggctttgcatta gtttactccatcacagcacagtctacatttaatgatttacaagatctgagagagcagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacaatggaacaac tgtgcattcttagagtcttctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcaaca tgtcagctgctttaa

DBGET integrated database retrieval system