Nyctereutes procyonoides (raccoon dog): 129512215 Help Entry 129512215         CDS       T09008                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo03050   Proteasome npo04060   Cytokine-cytokine receptor interaction npo04066   HIF-1 signaling pathway npo04217   Necroptosis npo04350   TGF-beta signaling pathway npo04380   Osteoclast differentiation npo04612   Antigen processing and presentation npo04630   JAK-STAT signaling pathway npo04650   Natural killer cell mediated cytotoxicity npo04657   IL-17 signaling pathway npo04658   Th1 and Th2 cell differentiation npo04659   Th17 cell differentiation npo04660   T cell receptor signaling pathway npo04940   Type I diabetes mellitus npo05140   Leishmaniasis npo05142   Chagas disease npo05143   African trypanosomiasis npo05144   Malaria npo05145   Toxoplasmosis npo05146   Amoebiasis npo05152   Tuberculosis npo05160   Hepatitis C npo05164   Influenza A npo05168   Herpes simplex virus 1 infection npo05200   Pathways in cancer npo05235   PD-L1 expression and PD-1 checkpoint pathway in cancer npo05321   Inflammatory bowel disease npo05322   Systemic lupus erythematosus npo05323   Rheumatoid arthritis npo05330   Allograft rejection npo05332   Graft-versus-host disease npo05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:npo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     129512215 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     129512215 (IFNG)    04630 JAK-STAT signaling pathway     129512215 (IFNG)    04066 HIF-1 signaling pathway     129512215 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129512215 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     129512215 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     129512215 (IFNG)    04612 Antigen processing and presentation     129512215 (IFNG)    04660 T cell receptor signaling pathway     129512215 (IFNG)    04658 Th1 and Th2 cell differentiation     129512215 (IFNG)    04659 Th17 cell differentiation     129512215 (IFNG)    04657 IL-17 signaling pathway     129512215 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     129512215 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129512215 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     129512215 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     129512215 (IFNG)    05164 Influenza A     129512215 (IFNG)    05168 Herpes simplex virus 1 infection     129512215 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     129512215 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     129512215 (IFNG)    05144 Malaria     129512215 (IFNG)    05145 Toxoplasmosis     129512215 (IFNG)    05140 Leishmaniasis     129512215 (IFNG)    05142 Chagas disease     129512215 (IFNG)    05143 African trypanosomiasis     129512215 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     129512215 (IFNG)    05323 Rheumatoid arthritis     129512215 (IFNG)    05321 Inflammatory bowel disease     129512215 (IFNG)    05330 Allograft rejection     129512215 (IFNG)    05332 Graft-versus-host disease     129512215 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     129512215 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     129512215 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:npo03051]     129512215 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:npo04052]     129512215 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:npo00536]     129512215 (IFNG) Proteasome [BR:npo03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     129512215 (IFNG) Cytokines and neuropeptides [BR:npo04052]  Cytokines   Interferons    129512215 (IFNG) Glycosaminoglycan binding proteins [BR:npo00536]  Heparan sulfate / Heparin   Cytokines    129512215 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma TssR_C Motif Other DBs NCBI-GeneID:  129512215 NCBI-ProteinID:  XP_055185454 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MNYTSYILAFQLCVILCSSGCNCQAMFFKEIENLKEYFNASNPDVSDGGSLFVDILKKWR EESDKTIIQSQIVSFYLKLFDNFKDNQIIQRSMDTIKEDMLGKFLNSSTSKREDFLKLIQ IPVNDLQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaattatacaagctatatcttagcttttcagctttgcgtgattttgtgttcttctggc tgtaactgtcaggccatgttttttaaagaaatagaaaacctaaaggaatattttaatgca agtaatccagatgtatcggacggtgggtctcttttcgtagatattttgaagaaatggaga gaggagagtgacaaaacaatcattcagagccaaattgtctctttctacttgaaactgttt gacaactttaaagataaccagatcattcaaaggagcatggataccatcaaggaagacatg cttggcaagttcctaaatagcagcaccagtaagagggaggacttccttaagctgattcaa attcctgtgaacgatctgcaggtccagcgcaaggcgataaatgaactcatcaaagtgatg aatgatctctcaccaagatccaacctaaggaagcggaaaaggagtcagaatctgtttcga ggccgcagagcatcgaaataa

DBGET integrated database retrieval system