Nyctereutes procyonoides (raccoon dog): 129512779 Help Entry 129512779         CDS       T09008                                  Symbol TNF Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo01523   Antifolate resistance npo04010   MAPK signaling pathway npo04060   Cytokine-cytokine receptor interaction npo04061   Viral protein interaction with cytokine and cytokine receptor npo04064   NF-kappa B signaling pathway npo04071   Sphingolipid signaling pathway npo04150   mTOR signaling pathway npo04210   Apoptosis npo04217   Necroptosis npo04350   TGF-beta signaling pathway npo04380   Osteoclast differentiation npo04612   Antigen processing and presentation npo04620   Toll-like receptor signaling pathway npo04621   NOD-like receptor signaling pathway npo04622   RIG-I-like receptor signaling pathway npo04625   C-type lectin receptor signaling pathway npo04640   Hematopoietic cell lineage npo04650   Natural killer cell mediated cytotoxicity npo04657   IL-17 signaling pathway npo04660   T cell receptor signaling pathway npo04664   Fc epsilon RI signaling pathway npo04668   TNF signaling pathway npo04920   Adipocytokine signaling pathway npo04930   Type II diabetes mellitus npo04931   Insulin resistance npo04932   Non-alcoholic fatty liver disease npo04933   AGE-RAGE signaling pathway in diabetic complications npo04936   Alcoholic liver disease npo04940   Type I diabetes mellitus npo05010   Alzheimer disease npo05014   Amyotrophic lateral sclerosis npo05020   Prion disease npo05022   Pathways of neurodegeneration - multiple diseases npo05132   Salmonella infection npo05133   Pertussis npo05134   Legionellosis npo05135   Yersinia infection npo05140   Leishmaniasis npo05142   Chagas disease npo05143   African trypanosomiasis npo05144   Malaria npo05145   Toxoplasmosis npo05146   Amoebiasis npo05152   Tuberculosis npo05160   Hepatitis C npo05161   Hepatitis B npo05163   Human cytomegalovirus infection npo05164   Influenza A npo05165   Human papillomavirus infection npo05166   Human T-cell leukemia virus 1 infection npo05168   Herpes simplex virus 1 infection npo05169   Epstein-Barr virus infection npo05170   Human immunodeficiency virus 1 infection npo05171   Coronavirus disease - COVID-19 npo05205   Proteoglycans in cancer npo05310   Asthma npo05321   Inflammatory bowel disease npo05322   Systemic lupus erythematosus npo05323   Rheumatoid arthritis npo05330   Allograft rejection npo05332   Graft-versus-host disease npo05410   Hypertrophic cardiomyopathy npo05414   Dilated cardiomyopathy npo05417   Lipid and atherosclerosis npo05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129512779 (TNF)    04350 TGF-beta signaling pathway     129512779 (TNF)    04064 NF-kappa B signaling pathway     129512779 (TNF)    04668 TNF signaling pathway     129512779 (TNF)    04071 Sphingolipid signaling pathway     129512779 (TNF)    04150 mTOR signaling pathway     129512779 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129512779 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     129512779 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     129512779 (TNF)    04217 Necroptosis     129512779 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     129512779 (TNF)    04620 Toll-like receptor signaling pathway     129512779 (TNF)    04621 NOD-like receptor signaling pathway     129512779 (TNF)    04622 RIG-I-like receptor signaling pathway     129512779 (TNF)    04625 C-type lectin receptor signaling pathway     129512779 (TNF)    04650 Natural killer cell mediated cytotoxicity     129512779 (TNF)    04612 Antigen processing and presentation     129512779 (TNF)    04660 T cell receptor signaling pathway     129512779 (TNF)    04657 IL-17 signaling pathway     129512779 (TNF)    04664 Fc epsilon RI signaling pathway     129512779 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     129512779 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     129512779 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     129512779 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     129512779 (TNF)    05170 Human immunodeficiency virus 1 infection     129512779 (TNF)    05161 Hepatitis B     129512779 (TNF)    05160 Hepatitis C     129512779 (TNF)    05171 Coronavirus disease - COVID-19     129512779 (TNF)    05164 Influenza A     129512779 (TNF)    05168 Herpes simplex virus 1 infection     129512779 (TNF)    05163 Human cytomegalovirus infection     129512779 (TNF)    05169 Epstein-Barr virus infection     129512779 (TNF)    05165 Human papillomavirus infection     129512779 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     129512779 (TNF)    05135 Yersinia infection     129512779 (TNF)    05133 Pertussis     129512779 (TNF)    05134 Legionellosis     129512779 (TNF)    05152 Tuberculosis     129512779 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     129512779 (TNF)    05144 Malaria     129512779 (TNF)    05145 Toxoplasmosis     129512779 (TNF)    05140 Leishmaniasis     129512779 (TNF)    05142 Chagas disease     129512779 (TNF)    05143 African trypanosomiasis     129512779 (TNF)   09163 Immune disease    05310 Asthma     129512779 (TNF)    05322 Systemic lupus erythematosus     129512779 (TNF)    05323 Rheumatoid arthritis     129512779 (TNF)    05321 Inflammatory bowel disease     129512779 (TNF)    05330 Allograft rejection     129512779 (TNF)    05332 Graft-versus-host disease     129512779 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     129512779 (TNF)    05014 Amyotrophic lateral sclerosis     129512779 (TNF)    05020 Prion disease     129512779 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     129512779 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129512779 (TNF)    05418 Fluid shear stress and atherosclerosis     129512779 (TNF)    05410 Hypertrophic cardiomyopathy     129512779 (TNF)    05414 Dilated cardiomyopathy     129512779 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     129512779 (TNF)    04940 Type I diabetes mellitus     129512779 (TNF)    04936 Alcoholic liver disease     129512779 (TNF)    04932 Non-alcoholic fatty liver disease     129512779 (TNF)    04931 Insulin resistance     129512779 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     129512779 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     129512779 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:npo04052]     129512779 (TNF)    00536 Glycosaminoglycan binding proteins [BR:npo00536]     129512779 (TNF) Cytokines and neuropeptides [BR:npo04052]  Cytokines   Tumor necrosis fators    129512779 (TNF) Glycosaminoglycan binding proteins [BR:npo00536]  Heparan sulfate / Heparin   Cytokines    129512779 (TNF) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  129512779 NCBI-ProteinID:  XP_055186300 LinkDB All DBs Position Unknown AA seq 247 aa AA seqDB search MSTESMIRDVELAEEPLPKKAGGPPGSRRCFCLSLFSFLLVAGATTLFCLLHFGVIAVSP LGVTCSDAKPPSSPQQLPNGLQLISPLAQTVKSSSRTPSDKPVAHVVANPEAEGQLQWLS RRANALLANGVELTDNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTK VNLLSAIKSPCQRETPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPNYLDFAESGQV YFGIIAL NT seq 744 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccgggacgtggagctggccgaggagccgctccccaagaag gcggggggccccccgggctccagaaggtgcttctgcctcagcctcttctccttcctcctc gtcgcaggagccaccacactcttctgcctgctgcactttggagtgatcgctgtttctcct ttaggggtgacttgctctgatgctaaacctccttcttctccccaacagctcccaaatggc ctccaactaatcagccctcttgcccagacagtcaaatcatcttctcgaaccccaagtgac aagccagtagctcatgttgtagcaaaccccgaagctgaggggcagctccagtggctgagc cgacgtgccaatgccctcctggccaacggcgtggagctgacagacaaccagctgatagtg ccatcagatgggttgtatctcatctactcccaggtcctcttcaagggccaaggatgccct tccacccatgtgctcctcacccacaccattagccgcttcgccgtctcctaccagacaaag gtcaacctactctctgccatcaagagcccttgccaaagggagaccccagaggggaccgag gccaagccctggtacgagcccatctacctgggaggggtcttccaactggagaagggtgat cgactcagcgctgagatcaatctgcctaactatctggactttgccgagtccgggcaggtg tactttggaatcattgccctgtaa

DBGET integrated database retrieval system