Nyctereutes procyonoides (raccoon dog): 129520159 Help Entry 129520159         CDS       T09008                                  Name (RefSeq) permeability factor 2-like   KO K05505   C-X-C motif chemokine 1/2/3 Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04060   Cytokine-cytokine receptor interaction npo04061   Viral protein interaction with cytokine and cytokine receptor npo04062   Chemokine signaling pathway npo04064   NF-kappa B signaling pathway npo04621   NOD-like receptor signaling pathway npo04657   IL-17 signaling pathway npo04668   TNF signaling pathway npo04936   Alcoholic liver disease npo05134   Legionellosis npo05146   Amoebiasis npo05167   Kaposi sarcoma-associated herpesvirus infection npo05323   Rheumatoid arthritis npo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     129520159    04668 TNF signaling pathway     129520159   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129520159    04061 Viral protein interaction with cytokine and cytokine receptor     129520159  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     129520159    04657 IL-17 signaling pathway     129520159    04062 Chemokine signaling pathway     129520159  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     129520159   09171 Infectious disease: bacterial    05134 Legionellosis     129520159   09174 Infectious disease: parasitic    05146 Amoebiasis     129520159   09163 Immune disease    05323 Rheumatoid arthritis     129520159   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129520159   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     129520159  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:npo04052]     129520159 Cytokines and neuropeptides [BR:npo04052]  Cytokines   Chemokines    129520159 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  129520159 NCBI-ProteinID:  XP_055197168 LinkDB All DBs Position Unknown AA seq 109 aa AA seqDB search MAPAAPRAPRAPRLPGSSALLLLLLLLLLGPAGTAGAPVVAELRCQCLQTLQGIHLKNIQ NVQVTPSGPHCARTEVIAALKDGREVCLNPEAPLVKRMIQKILSKGSTN NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atggcccccgccgcgccccgcgccccccgcgccccccggctccccggctcctccgcgctg ctgctcctgctcctgctcctgctcctgggccccgcggggaccgcaggggcgccggtggtc gccgagctgcgctgccagtgcttgcagaccctgcagggaatccacctcaagaacatccag aacgtccaggtgacgccctcaggaccccactgcgcccgaaccgaggtcatagccgcgctc aaggacggacgcgaggtgtgtctcaaccccgaggccccgctggtcaagagaatgatccag aagatcctgagcaagggcagcaccaactga

DBGET integrated database retrieval system