Nanorana parkeri (Xizang Plateau frog): 108788200 Help Entry 108788200         CDS       T04897                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism npr  Nanorana parkeri (Xizang Plateau frog) Pathway npr03420   Nucleotide excision repair npr04110   Cell cycle npr04114   Oocyte meiosis npr04120   Ubiquitin mediated proteolysis npr04141   Protein processing in endoplasmic reticulum npr04310   Wnt signaling pathway npr04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:npr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108788200 (RBX1)    04120 Ubiquitin mediated proteolysis     108788200 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     108788200 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     108788200 (RBX1)    04350 TGF-beta signaling pathway     108788200 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     108788200 (RBX1)    04114 Oocyte meiosis     108788200 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:npr04121]     108788200 (RBX1)    03400 DNA repair and recombination proteins [BR:npr03400]     108788200 (RBX1) Enzymes [BR:npr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      108788200 (RBX1) Ubiquitin system [BR:npr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    108788200 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      108788200 (RBX1)    Cul2 complex      108788200 (RBX1)    Cul3 complex      108788200 (RBX1)    Cul4 complex      108788200 (RBX1)    Cul7 complex      108788200 (RBX1)    Cul8 complex      108788200 (RBX1)    Cul9 complex      108788200 (RBX1) DNA repair and recombination proteins [BR:npr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       108788200 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       108788200 (RBX1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  108788200 NCBI-ProteinID:  XP_018413438 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MRCKDGSECDTSTVKAGFFVALGMAAAMDVDVPSGANSSAGKKRFEVKKWNAVALWAWDI VVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLD NREWEFQK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgcgctgtaaggacggaagtgagtgtgacacaagcactgtaaaggccgggttttttgtt gcgttgggaatggccgctgcaatggatgtggatgttccaagtggagctaatagcagtgct gggaaaaagcggtttgaggtgaaaaagtggaatgcagttgctctttgggcttgggacatc gtagttgataactgtgcgatctgcagaaaccatattatggacctgtgtatagaatgtcaa gctaatcaagcatcggccacctctgaagaatgtactgtggcatggggagtatgcaatcat gcattccactttcattgcatttcccgttggttgaagactcgacaagtttgtccacttgat aacagagaatgggaatttcaaaagtaa

DBGET integrated database retrieval system