Nanorana parkeri (Xizang Plateau frog): 108798108 Help Entry 108798108         CDS       T04897                                  Symbol CXCL12 Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism npr  Nanorana parkeri (Xizang Plateau frog) Pathway npr04060   Cytokine-cytokine receptor interaction npr04672   Intestinal immune network for IgA production npr04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:npr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108798108 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     108798108 (CXCL12)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     108798108 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:npr04052]     108798108 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:npr00536]     108798108 (CXCL12) Cytokines and neuropeptides [BR:npr04052]  Cytokines   Chemokines    108798108 (CXCL12) Glycosaminoglycan binding proteins [BR:npr00536]  Heparan sulfate / Heparin   Chemokines    108798108 (CXCL12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  108798108 NCBI-ProteinID:  XP_018425326 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search MDVRTLTLLILLLGTICLSYEKPVSLTYRCPCRYFESNVAKSNIKHLKILSTTNCSLQIV ARLKHNGKQICLDPKIKWIQEFLEKAMNK NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggacgtaaggaccctgactcttctcatcctcctgctggggacaatctgcctctcttat gagaaaccggtcagcttgacttaccgatgtccctgcagatactttgaaagcaacgtggcc aagagcaacatcaaacacctgaagatcctctccaccaccaactgttcactgcagattgtg gctcgtcttaaacacaatgggaaacagatttgcttggaccccaagattaaatggatccag gagttcctggagaaagctatgaacaagtaa

DBGET integrated database retrieval system