Nanorana parkeri (Xizang Plateau frog): 108802028 Help Entry 108802028         CDS       T04897                                  Symbol POLE4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism npr  Nanorana parkeri (Xizang Plateau frog) Pathway npr03030   DNA replication npr03410   Base excision repair npr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:npr00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     108802028 (POLE4)    03410 Base excision repair     108802028 (POLE4)    03420 Nucleotide excision repair     108802028 (POLE4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:npr03032]     108802028 (POLE4)    03400 DNA repair and recombination proteins [BR:npr03400]     108802028 (POLE4) Enzymes [BR:npr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      108802028 (POLE4) DNA replication proteins [BR:npr03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     108802028 (POLE4) DNA repair and recombination proteins [BR:npr03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       108802028 (POLE4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C CENP-S Motif Other DBs NCBI-GeneID:  108802028 NCBI-ProteinID:  XP_018429420 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MAAEEEAVVLDIAVKHTDGSEAELCVKQAGEKSECVTAPIPKLVKLPLSRVKALMKFDPE VSLASREAVFLISKATEILIQTIAKDAHVYAQRNKRKTLQRRDIGLNFIS NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggctgctgaggaggaggcagtagtgttggatatcgcagtaaaacacacagacggttct gaagctgagctgtgtgtcaagcaggcgggtgagaagtccgaatgcgtcactgctccaata ccgaaactcgtgaagcttccgttgtcgcgggtgaaagcgttaatgaaattcgatccggag gtgtccctggctagtcgggaggccgtcttccttataagcaaggctacggaaatattaata caaacaattgctaaagatgcacatgtgtatgcccaacgtaacaagaggaaaactctgcag cgtcgagatataggtttgaattttatttcttag

DBGET integrated database retrieval system