Nicotiana sylvestris (wood tobacco): 104236463 Help Entry 104236463         CDS       T05026                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism nsy  Nicotiana sylvestris (wood tobacco) Pathway nsy03420   Nucleotide excision repair nsy04120   Ubiquitin mediated proteolysis nsy04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nsy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104236463    04120 Ubiquitin mediated proteolysis     104236463   09124 Replication and repair    03420 Nucleotide excision repair     104236463  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:nsy04121]     104236463    03400 DNA repair and recombination proteins [BR:nsy03400]     104236463 Enzymes [BR:nsy01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      104236463 Ubiquitin system [BR:nsy04121]  Ubiquitin ligases (E3)   UBL E3 ligases    104236463   Multi subunit type E3    SCF complex     Ring finger protein      104236463    Cul2 complex      104236463    Cul3 complex      104236463    Cul4 complex      104236463    Cul7 complex      104236463    Cul8 complex      104236463    Cul9 complex      104236463 DNA repair and recombination proteins [BR:nsy03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       104236463     TCR (transcription coupled repair) factors      Cul4-CSA complex       104236463 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  104236463 NCBI-ProteinID:  XP_009788689 UniProt:  A0A1U7XP14 LinkDB All DBs Position 3:187710609..187719029 Genome browser AA seq 123 aa AA seqDB search MDTDVEMVPAGEESIAAAAATSSASAASSSTKKPKRFEIKKWNAVALWAWDIVVDNCAIC RNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQK YGH NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggatacagacgtcgagatggttcccgccggtgaagaatccatcgctgcagcagcagca acttcatcagcatctgctgcttcttcttccactaagaagccgaaacgttttgagataaaa aaatggaatgctgtcgctctttgggcttgggatatcgttgtggacaactgtgctatttgc aggaatcatattatggatctatgcatcgaatgccaagctaatcaagctagtgctacgagt gaggagtgcactgttgcttggggtgtatgtaaccatgccttccacttccactgcatcagt cgctggctcaaaacccgtcaagtgtgtccattagataatagtgagtgggaatttcagaag tatggtcactag

DBGET integrated database retrieval system