Nicotiana tabacum (common tobacco): 107775681 Help Entry 107775681         CDS       T04643                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism nta  Nicotiana tabacum (common tobacco) Pathway nta03083   Polycomb repressive complex nta04120   Ubiquitin mediated proteolysis nta04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nta00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107775681    04120 Ubiquitin mediated proteolysis     107775681   09126 Chromosome    03083 Polycomb repressive complex     107775681  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nta04131]     107775681    04121 Ubiquitin system [BR:nta04121]     107775681    03036 Chromosome and associated proteins [BR:nta03036]     107775681 Membrane trafficking [BR:nta04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     107775681 Ubiquitin system [BR:nta04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      107775681    Cul7 complex      107775681 Chromosome and associated proteins [BR:nta03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      107775681   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      107775681 SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ DUF1221 BTB Pho88 PCNA_C Motif Other DBs NCBI-GeneID:  107775681 NCBI-ProteinID:  XP_075080570 UniProt:  A0AC58S6E8 LinkDB All DBs Position 11:149580492..149580761 Genome browser AA seq 89 aa AA seqDB search MVEHDDASSIIPLPNVDTKTLVKIIEYLKKHAEISGSDEEEIKKTKSKDFDKEFVSVKMQ RLVNIIFAANFLHIKALLGHCAQAIADKI NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggtagaacatgatgatgcatccagcatcataccactacccaacgttgacactaaaacc ctagtcaagattatcgagtacctcaagaagcatgcagaaatctcgggttcagatgaagaa gaaattaagaaaacaaaaagtaaggactttgataaggaattcgttagcgttaagatgcaa agactcgtcaacatcatatttgctgcgaatttccttcacattaaggctttgctcggtcat tgtgctcaggctattgctgacaagatataa

DBGET integrated database retrieval system