Nicotiana tabacum (common tobacco): 107784370 Help Entry 107784370         CDS       T04643                                  Name (RefSeq) centromere protein S-like   KO K11511   centromere protein S Organism nta  Nicotiana tabacum (common tobacco) Pathway nta03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:nta00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     107784370  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nta03036]     107784370    03400 DNA repair and recombination proteins [BR:nta03400]     107784370 Chromosome and associated proteins [BR:nta03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      107784370 DNA repair and recombination proteins [BR:nta03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      107784370 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Bromo_TP TFIID-31kDa DUF6989 Motif Other DBs NCBI-GeneID:  107784370 NCBI-ProteinID:  XP_016460988 UniProt:  A0A1S3Z9D6 LinkDB All DBs Position Un AA seq 140 aa AA seqDB search MEDIDGGEMASELDREEEESATDLLRDRFRLCTISIAEAEAKQCGMEVSQPIMACISDLA FKFAEQLAKDLELFAQHAGRKSVNMEDVILSAHRNDHLAASLRSFGNDLKAKEPNLERKK KKSSRREDKVVRDVLRTPDY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggaggatatcgacggaggagaaatggcaagcgaattagacagagaagaggaagaatca gccaccgacttactccgtgatcgattccgattatgcactatttccattgctgaagccgag gcgaaacaatgtggtatggaggtttctcaaccgattatggcttgcatttctgatttagcc ttcaagtttgcagaacagctagcaaaagaccttgaattatttgcccagcatgctggtcgt aagtccgtaaacatggaagatgttattctttccgcacatcggaatgatcacctggctgcc tcattgaggtccttcggcaatgacctaaaagcaaaagagcccaatttggagaggaagaag aagaagagttccagaagggaagataaagttgttcgagatgtacttcgtactccagactat tag

DBGET integrated database retrieval system