Nicotiana tabacum (common tobacco): 107785818 Help Entry 107785818         CDS       T04643                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism nta  Nicotiana tabacum (common tobacco) Pathway nta04145   Phagosome nta04148   Efferocytosis nta04620   Toll-like receptor signaling pathway nta05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:nta00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     107785818    04148 Efferocytosis     107785818  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107785818  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     107785818  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nta04131]     107785818   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nta04147]     107785818    04031 GTP-binding proteins [BR:nta04031]     107785818 Membrane trafficking [BR:nta04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     107785818  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     107785818   Macropinocytosis    Ras GTPases     107785818  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     107785818 Exosome [BR:nta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107785818   Exosomal proteins of other body fluids (saliva and urine)    107785818   Exosomal proteins of colorectal cancer cells    107785818   Exosomal proteins of bladder cancer cells    107785818 GTP-binding proteins [BR:nta04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     107785818 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  107785818 NCBI-ProteinID:  XP_016462687 UniProt:  A0A1S3ZEK2 LinkDB All DBs Position Un AA seq 154 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYANDTFPTVCVPTVFDHFSADVVVDGSTVNLGLWD TAGQEDYNRLRPLSYPEADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL ELFFGEKRSSVGSSRSHKFLIWQVKCNCDIAAIP NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtctaggttcataaagtgtgtcaccgttggcgatggagctgtgggtaaaact tgtcttctcatttcctatgccaacgacacttttcccactgtttgcgtcccaactgtattc gaccattttagtgcagatgtggttgtcgatgggagcactgtcaatctggggctctgggat actgcaggtcaggaggattacaatagattaagaccgttgagctatcccgaggcagatgta tttatactggcgttttctctcattagcaaagcgagctatgaaaatgtctccaaaaagtgg attcctgagttgaggcattatgctcctggagttccaattattcttgttggaacaaagcta gagctgttttttggggaaaaaaggagctctgtaggaagttccaggtcacataagttcctt atttggcaagtcaaatgcaattgtgatattgctgctattccctag

DBGET integrated database retrieval system