Nicotiana tabacum (common tobacco): 107789974 Help Entry 107789974         CDS       T04643                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism nta  Nicotiana tabacum (common tobacco) Pathway nta03083   Polycomb repressive complex nta04120   Ubiquitin mediated proteolysis nta04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nta00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107789974    04120 Ubiquitin mediated proteolysis     107789974   09126 Chromosome    03083 Polycomb repressive complex     107789974  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nta04131]     107789974    04121 Ubiquitin system [BR:nta04121]     107789974    03036 Chromosome and associated proteins [BR:nta03036]     107789974 Membrane trafficking [BR:nta04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     107789974 Ubiquitin system [BR:nta04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      107789974    Cul7 complex      107789974 Chromosome and associated proteins [BR:nta03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      107789974   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      107789974 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Ribosomal_L7Ae BTB Motif Other DBs NCBI-GeneID:  107789974 NCBI-ProteinID:  XP_016467343 UniProt:  A0A1S3ZSR1 LinkDB All DBs Position Un AA seq 156 aa AA seqDB search MSTSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYC KRHVDAVAKTDDKASEDDLKSFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgtctacttcaaaaatgattgtgttgaagagttccgacggcgaaactttcgaggtggaa gaggcggtggcgttggaatcacagaccataaaacacatgatcgaagacgattgtgctgat actagtatccctctccctaatgttacgagcaagatcttggctaaggttattgagtactgt aagcgccacgtcgatgctgttgctaagacggatgataaagcatctgaggatgatttaaaa agctttgatgctgactttgtcaaagttgatcaggctactctctttgatcttatcttggct gctaactatttgaacatcaagagtctgcttgatctcacttgtcagactgtggcagacatg atcaaggggaaaactccggaggagatccgcaagaccttcaacatcaagaatgacttcaca cctgaggaagaggaggaagttaggagggagaatgcctgggcctttgagtga

DBGET integrated database retrieval system