Nicotiana tabacum (common tobacco): 107794005 Help Entry 107794005         CDS       T04643                                  Name (RefSeq) ADP-ribosylation factor 1   KO K07937   ADP-ribosylation factor 1/2 Organism nta  Nicotiana tabacum (common tobacco) Pathway nta04144   Endocytosis Brite KEGG Orthology (KO) [BR:nta00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107794005  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nta04131]     107794005   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nta04147]     107794005    04031 GTP-binding proteins [BR:nta04031]     107794005 Membrane trafficking [BR:nta04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     107794005   Arf GTPases and associated proteins    Arf GTPases     107794005  Endosome - Golgi transport     107794005 Exosome [BR:nta04147]  Exosomal proteins   Proteins found in most exosomes    107794005 GTP-binding proteins [BR:nta04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     107794005 SSDB OrthologParalogGFIT Motif Pfam:  Arf G-alpha Roc SRPRB Ras Gtr1_RagA MMR_HSR1 6PF2K DUF5648 Motif Other DBs NCBI-GeneID:  107794005 NCBI-ProteinID:  XP_075094012 UniProt:  A0AC58T9V3 LinkDB All DBs Position 19:complement(68971216..68974979) Genome browser AA seq 114 aa AA seqDB search MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEA NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggggctgtctttcggcaagcttttcagtcggcttttcgccaagaaagagatgcgcata ctgatggtgggtctcgatgctgctggtaaaacgaccatcttgtacaaactcaaactggga gagatcgtcaccactatccctaccattggtttcaatgtggagaccgtggaatacaaaaac attagctttacagtttgggatgtcgggggtcaggataagattcgtcctttgtggagacac tacttccaaaacacccagggactcatctttgtggttgatagcaatgacagagatcgtgta gttgaagctagggatgagcttcacaggatgttgaatgaggcatag

DBGET integrated database retrieval system