Nicotiana tabacum (common tobacco): 107794237 Help Entry 107794237         CDS       T04643                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism nta  Nicotiana tabacum (common tobacco) Pathway nta03083   Polycomb repressive complex nta04120   Ubiquitin mediated proteolysis nta04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nta00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107794237    04120 Ubiquitin mediated proteolysis     107794237   09126 Chromosome    03083 Polycomb repressive complex     107794237  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nta04131]     107794237    04121 Ubiquitin system [BR:nta04121]     107794237    03036 Chromosome and associated proteins [BR:nta03036]     107794237 Membrane trafficking [BR:nta04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     107794237 Ubiquitin system [BR:nta04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      107794237    Cul7 complex      107794237 Chromosome and associated proteins [BR:nta03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      107794237   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      107794237 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ DUF7667 BTB Motif Other DBs NCBI-GeneID:  107794237 NCBI-ProteinID:  XP_016472204 UniProt:  A0A1S4A6H3 LinkDB All DBs Position 17:complement(110621069..110621660) Genome browser AA seq 151 aa AA seqDB search MSSKKLLVLKTRDGEEFELDEAVAVRSEAIKNMVEDDCASNAIPLPNVDSKTMAKVVEYW KKHSEEGVSGDELKDFDKNFVKVLNYSELYDLILAANYLNDKELLDILCQETADRIKGKT PEEIRKAFNIKNDFTPEEEEQIRQENAWAFD NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtcttccaagaaactcttagtcttaaagacaagagatggcgaggaattcgaacttgac gaggcagtggccgtgaggtcagaagccatcaaaaatatggtggaagatgattgcgcttca aacgccattcctctgcctaatgtcgacagtaaaacaatggccaaagtggtcgaatactgg aaaaaacactccgaggagggcgtctccggggacgagttgaaggattttgacaagaatttt gtgaaggtgctgaattactcagagttgtatgatctaattttagctgctaattatcttaat gataaggagctattggatatattgtgtcaagaaactgctgataggattaaagggaaaacg ccagaggaaatacgtaaagcatttaatatcaagaatgattttacccctgaagaagaggag caaatccgtcaagagaatgcttgggcctttgattga

DBGET integrated database retrieval system