Nicotiana tabacum (common tobacco): 107794584 Help Entry 107794584         CDS       T04643                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism nta  Nicotiana tabacum (common tobacco) Pathway nta04016   MAPK signaling pathway - plant nta04070   Phosphatidylinositol signaling system nta04075   Plant hormone signal transduction nta04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:nta00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     107794584    04070 Phosphatidylinositol signaling system     107794584    04075 Plant hormone signal transduction     107794584  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     107794584  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:nta01009]     107794584   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nta04131]     107794584    03036 Chromosome and associated proteins [BR:nta03036]     107794584   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nta04147]     107794584 Protein phosphatases and associated proteins [BR:nta01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      107794584 Membrane trafficking [BR:nta04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     107794584 Chromosome and associated proteins [BR:nta03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      107794584 Exosome [BR:nta04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    107794584 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 SPARC_Ca_bdg EH Dockerin_1 RNA_pol_Rpb4 TerB SPEF2_C EF-hand_11 DUF5580_M EF_EFCAB10_C PA_Ig-like Fe_hyd_lg_C FAD-depend_C Motif Other DBs NCBI-GeneID:  107794584 NCBI-ProteinID:  XP_016472565 UniProt:  A0A1S4A7F5 LinkDB All DBs Position Un AA seq 147 aa AA seqDB search MADALSEEQISEFREAFWVIDKDCDGVIRMEELAAVIQSLNEHPTKEEIQEMVNEVDPDG DGTIDFEDFLNIMARKLKDNVSEELKEAFKVFDRDQDGFISANELRNVMMNLGERLTDEE AQQMIREADLDGDGLVSYEEFVKIMII NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggctgatgcattgtcagaagaacaaatttctgagtttcgtgaagctttctgggttatt gacaaggattgtgatggggtgataagaatggaggaacttgcggcagtaatccaatcttta aatgaacatccaaccaaggaagagattcaagaaatggtaaacgaagtggatcctgatggt gatggcactattgattttgaagatttcttgaatatcatggctagaaaactcaaggacaac gtatcagaagaactaaaagaagcattcaaagtatttgatcgagatcaagatggatttatt tcagctaatgagttaagaaatgtgatgatgaatttgggagaaagattaacagatgaagaa gcccaacagatgatcagagaggcagatcttgatggagatggtctcgttagctatgaggaa tttgttaagatcatgattatttga

DBGET integrated database retrieval system