Nicotiana tabacum (common tobacco): 107796822 Help Entry 107796822         CDS       T04643                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism nta  Nicotiana tabacum (common tobacco) Pathway nta03083   Polycomb repressive complex nta04120   Ubiquitin mediated proteolysis nta04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nta00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107796822    04120 Ubiquitin mediated proteolysis     107796822   09126 Chromosome    03083 Polycomb repressive complex     107796822  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nta04131]     107796822    04121 Ubiquitin system [BR:nta04121]     107796822    03036 Chromosome and associated proteins [BR:nta03036]     107796822 Membrane trafficking [BR:nta04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     107796822 Ubiquitin system [BR:nta04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      107796822    Cul7 complex      107796822 Chromosome and associated proteins [BR:nta03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      107796822   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      107796822 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ AROS YtxC Bcl-2 Motif Other DBs NCBI-GeneID:  107796822 NCBI-ProteinID:  XP_016475129 UniProt:  A0A1S4AES9 LinkDB All DBs Position Un AA seq 164 aa AA seqDB search MASSTTGEKKMLTLKSGDNEEFYVEESLVLQSDLIKIMVKEERVSTIPLPSIKSKTLVKI IEYLKKHAELTTTSNNEDFKNFQKEFVNVVLEELLDITVTVNNLKISGLLEFCCQAVADR IKDKSVQAVQKIFKIESDFTSEEVAEFKRETPWAFEGDLDDTTN NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atggcatcatcaacaacgggagaaaagaaaatgttgacattgaagagcggtgataacgaa gaattttatgttgaggaatctttggtcttacagtctgatcttatcaaaatcatggtaaaa gaggaacgtgtttccaccatcccattgcctagcatcaaaagcaagacgctggttaaaatc attgaatacctcaagaaacatgcggagctcactactacctcgaacaatgaagatttcaag aatttccagaaagagtttgtgaatgttgttttagaggaactacttgacataaccgtgaca gtaaataatctgaaaatcagtggtttgctggaattctgttgccaggctgtggctgacaga ataaaggacaagagcgttcaagccgttcagaagatttttaaaattgaaagtgatttcacc tcagaagaagtggcagagtttaaaagggaaactccttgggcctttgaaggtgaccttgat gataccaccaactag

DBGET integrated database retrieval system