Nicotiana tabacum (common tobacco): 107799203 Help Entry 107799203         CDS       T04643                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism nta  Nicotiana tabacum (common tobacco) Pathway nta04145   Phagosome nta04148   Efferocytosis nta04620   Toll-like receptor signaling pathway nta05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:nta00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     107799203    04148 Efferocytosis     107799203  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107799203  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     107799203  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nta04131]     107799203   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nta04147]     107799203    04031 GTP-binding proteins [BR:nta04031]     107799203 Membrane trafficking [BR:nta04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     107799203  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     107799203   Macropinocytosis    Ras GTPases     107799203  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     107799203 Exosome [BR:nta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107799203   Exosomal proteins of other body fluids (saliva and urine)    107799203   Exosomal proteins of colorectal cancer cells    107799203   Exosomal proteins of bladder cancer cells    107799203 GTP-binding proteins [BR:nta04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     107799203 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  107799203 NCBI-ProteinID:  XP_016477775 UniProt:  Q9ZRD2 LinkDB All DBs Position Un AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL DLREDKQFFLDHPGAVPLTTAQGEELRKSIGASAYIECSAKTQQNVKAVFDAAIKVVLQP PKQKKKKKRKGQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtccaggttcataaagtgtgtcaccgttggcgacggggctgtgggtaaaact tgtcttctcatttcatataccagcaacacttttcccactgattacgttccaactgtattc gacaattttagtgcaaatgtggttgtcgatgggagcactgtcaatctggggctgtgggat actgcaggtcaggaggattacaatagattaagaccgttgagctatcgtggggcagatgta tttatactggcattttctctcattagcaaagcgagctatgaaaatgtctccaaaaagtgg attcctgaattgaggcattatgctcctggagttccaattattcttgttggaacaaagcta gatctccgagaggataagcaattcttcctggaccatccaggtgctgttccacttactaca gctcagggtgaggagctgagaaagtcgattggtgcttccgcttatattgaatgtagtgca aaaacacaacagaatgtgaaggctgtttttgatgccgccattaaggtggttctgcaacca cccaaacaaaagaagaaaaagaagagaaagggtcagaaagcctgctctatcttgtga

DBGET integrated database retrieval system