Nicotiana tabacum (common tobacco): 107808327 Help Entry 107808327         CDS       T04643                                  Symbol NTGP3, rac2 Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism nta  Nicotiana tabacum (common tobacco) Pathway nta04145   Phagosome nta04148   Efferocytosis nta04620   Toll-like receptor signaling pathway nta05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:nta00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     107808327 (NTGP3)    04148 Efferocytosis     107808327 (NTGP3)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107808327 (NTGP3)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     107808327 (NTGP3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nta04131]     107808327 (NTGP3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nta04147]     107808327 (NTGP3)    04031 GTP-binding proteins [BR:nta04031]     107808327 (NTGP3) Membrane trafficking [BR:nta04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     107808327 (NTGP3)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     107808327 (NTGP3)   Macropinocytosis    Ras GTPases     107808327 (NTGP3)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     107808327 (NTGP3) Exosome [BR:nta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107808327 (NTGP3)   Exosomal proteins of other body fluids (saliva and urine)    107808327 (NTGP3)   Exosomal proteins of colorectal cancer cells    107808327 (NTGP3)   Exosomal proteins of bladder cancer cells    107808327 (NTGP3) GTP-binding proteins [BR:nta04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     107808327 (NTGP3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  107808327 NCBI-ProteinID:  XP_016488326 UniProt:  Q9ZRD2 LinkDB All DBs Position Un AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL DLREDKQFFLDHPGAVPLTTAQGEELRKSIGASAYIECSAKTQQNVKAVFDAAIKVVLQP PKQKKKKKRKGQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtctaggttcataaagtgtgtcaccgttggcgacggagctgtgggtaaaact tgtcttctcatttcctataccagcaacacatttcccactgattacgtcccaactgtattc gacaattttagtgcaaatgtggttgtcgatgggagcactgtcaatctggggctgtgggat actgcaggtcaggaggattacaatagattaagaccgttgagctaccggggggcagatgta tttatactggcattttctctcattagcaaagcgagctatgaaaatgtctccaaaaagtgg attcctgaattgaggcattatgctcctggagttccaattattcttgttggaacaaagcta gatctccgagaggataagcaattcttcctggaccatccaggtgctgttccacttaccaca gctcagggtgaagagctgagaaagtcgattggtgcttccgcttacattgaatgtagtgca aaaacacaacagaatgtgaaggctgtttttgatgctgccattaaggtggttctacaacca cccaaacaaaagaagaaaaagaagagaaagggtcaaaaagcctgctctatcttgtga

DBGET integrated database retrieval system