Nicotiana tabacum (common tobacco): 107810713 Help Entry 107810713         CDS       T04643                                  Symbol rac4 Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism nta  Nicotiana tabacum (common tobacco) Pathway nta04145   Phagosome nta04148   Efferocytosis nta04620   Toll-like receptor signaling pathway nta05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:nta00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     107810713 (rac4)    04148 Efferocytosis     107810713 (rac4)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107810713 (rac4)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     107810713 (rac4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nta04131]     107810713 (rac4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nta04147]     107810713 (rac4)    04031 GTP-binding proteins [BR:nta04031]     107810713 (rac4) Membrane trafficking [BR:nta04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     107810713 (rac4)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     107810713 (rac4)   Macropinocytosis    Ras GTPases     107810713 (rac4)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     107810713 (rac4) Exosome [BR:nta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107810713 (rac4)   Exosomal proteins of other body fluids (saliva and urine)    107810713 (rac4)   Exosomal proteins of colorectal cancer cells    107810713 (rac4)   Exosomal proteins of bladder cancer cells    107810713 (rac4) GTP-binding proteins [BR:nta04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     107810713 (rac4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  107810713 NCBI-ProteinID:  NP_001312792 UniProt:  Q8GT44 LinkDB All DBs Position Un AA seq 210 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVEGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENILKKWIPELQHYAPGIPVVLAGT KLDLREDKHFLADHPGLVPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAAIKVVI KPPQKQKEKKKQRRGCLMNVMCGRKLVCLK NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atggcctcaagtgcttcaagattcatcaaatgtgtcacggttggtgatggtgccgttgga aagacttgtatgcttatttgctataccagtaacaagttccccactgattatgttcccaca gtgtttgacaacttcagtgccaatgtggttgtcgaagggaccacagtaaatttaggtctt tgggatactgcaggccaagaagattataacagattaaggccactgagctaccgaggagca gatgtttttgtcctagcgttctccttggttagtcgcgcaagctacgagaacatacttaaa aagtggattcctgaacttcagcattatgctcctggaataccggtggtattagctggcacc aaacttgatcttcgtgaggataagcacttcttggctgatcatcctggattagttcctgtc accaccgcgcagggagaggagctacggaaacaaattggtgctgcctattacatcgaatgt agctctaaaacacaacagaatgtgaaagctgtctttgatgctgcaatcaaggtcgtcatc aagccaccgcagaagcaaaaggagaagaagaaacaacgtcgaggatgtctcatgaatgtg atgtgcggaaggaagctcgtttgtttgaagtga

DBGET integrated database retrieval system