Nicotiana tabacum (common tobacco): 107816818 Help Entry 107816818         CDS       T04643                                  Name (RefSeq) uncharacterized LOC107816818   KO K12456   anaphase-promoting complex subunit 13 Organism nta  Nicotiana tabacum (common tobacco) Pathway nta04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:nta00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     107816818  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:nta04121]     107816818    03036 Chromosome and associated proteins [BR:nta03036]     107816818 Ubiquitin system [BR:nta04121]  Ubiquitin ligases (E3)   Multi subunit type E3    APC/C     Other subunits      107816818 Chromosome and associated proteins [BR:nta03036]  Eukaryotic type   Sister chromatid separation proteins    APC/C complex     107816818 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Apc13p Motif Other DBs NCBI-GeneID:  107816818 NCBI-ProteinID:  XP_016498047 UniProt:  A0A1S4C9X6 LinkDB All DBs Position Un AA seq 65 aa AA seqDB search MAEQILSLGVLIDIVDEEWMRDTLPEDDLPLPPVLLPKTDDNEDSNQEAQQVDGDTWHDL ALGNP NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atggcagagcaaatcctcagcttaggagtcctcatagatattgtggatgaggaatggatg cgagatactttgcctgaagatgatctcccattaccacccgtactacttccaaagaccgac gacaatgaagactcaaatcaagaggctcaacaagttgatggggatacatggcatgacctt gcattgggaaatccatga

DBGET integrated database retrieval system