Nicotiana tabacum (common tobacco): 107820484 Help Entry 107820484         CDS       T04643                                  Name (RefSeq) histone H3.2-like   KO K11253   histone H3 Organism nta  Nicotiana tabacum (common tobacco) Brite KEGG Orthology (KO) [BR:nta00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nta03036]     107820484   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nta04147]     107820484 Chromosome and associated proteins [BR:nta03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107820484 Exosome [BR:nta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107820484 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  107820484 NCBI-ProteinID:  XP_016502259 UniProt:  A0A1S4CMS4 LinkDB All DBs Position Un AA seq 113 aa AA seqDB search MARTKQIARKSTKGKSQRKQLARKAVRESAPATEGVKKPHRFRPGTVALREICKYQKLTE LSNVWFERELKTNLRFQSSAVAELEEASDDFGVEKDEINQRISGKNLLKDRIF NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaaacaaattgcccgaaaatccaccaaagggaaatctcagagaaagcaa ttagccagaaaagcagtcagagagtcagctccggcaaccgaaggagtgaagaagcctcac agattcaggccagggacagtggcgctccgtgaaatttgcaagtaccagaaattgactgag ctttccaacgtttggttcgagagagagctcaagactaatctccgctttcagagttcggct gtggctgagcttgaggaagcttctgatgactttggtgttgaaaaggatgaaattaatcaa aggatttcgggtaaaaaccttttaaaggaccgaatattttaa

DBGET integrated database retrieval system