Nicotiana tabacum (common tobacco): 107822281 Help Entry 107822281         CDS       T04643                                  Name (RefSeq) SKP1-like protein 5   KO K03094   S-phase kinase-associated protein 1 Organism nta  Nicotiana tabacum (common tobacco) Pathway nta03083   Polycomb repressive complex nta04120   Ubiquitin mediated proteolysis nta04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nta00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107822281    04120 Ubiquitin mediated proteolysis     107822281   09126 Chromosome    03083 Polycomb repressive complex     107822281  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nta04131]     107822281    04121 Ubiquitin system [BR:nta04121]     107822281    03036 Chromosome and associated proteins [BR:nta03036]     107822281 Membrane trafficking [BR:nta04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     107822281 Ubiquitin system [BR:nta04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      107822281    Cul7 complex      107822281 Chromosome and associated proteins [BR:nta03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      107822281   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      107822281 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 DUF1221 Motif Other DBs NCBI-GeneID:  107822281 NCBI-ProteinID:  XP_075084776 UniProt:  A0AC58SII8 LinkDB All DBs Position 13:23914717..23918452 Genome browser AA seq 132 aa AA seqDB search MFSSKASFLVKIIEYLKKHAEIKGSDEEEIKKTKIKDFDKEFISVKMQKLFNIILVANFL DIKPLLDLCAQAIADKIKNKSHVVVRQNFNVQCDYTREEEDVVRKENEWVFLSQEVSPKR WNGPESPPSFSC NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgttttcatctaaggcatccttcctagtcaagatcatcgagtacctcaagaagcatgca gaaatcaagggttcagacgaagaagaaatcaagaaaaccaaaatcaaggacttcgataag gaattcattagcgttaagatgcaaaaactcttcaatatcatattggttgcaaatttcctt gacattaagcctttgctcgatctttgtgctcaggctattgctgacaagatcaagaacaag tcgcatgtggttgttcgacaaaatttcaatgttcaatgtgattatactcgagaggaagaa gatgtcgttcggaaagaaaatgaatgggtatttttgagtcaagaagttagcccaaagaga tggaatggtcctgagtctccaccatcttttagttgctaa

DBGET integrated database retrieval system