Nicotiana tabacum (common tobacco): 107823953 Help Entry 107823953         CDS       T04643                                  Name (RefSeq) ras-related protein Rab7   KO K07897   Ras-related protein Rab-7A Organism nta  Nicotiana tabacum (common tobacco) Pathway nta04144   Endocytosis nta04145   Phagosome nta04148   Efferocytosis Brite KEGG Orthology (KO) [BR:nta00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107823953    04145 Phagosome     107823953    04148 Efferocytosis     107823953  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nta04131]     107823953   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nta04147]     107823953    04031 GTP-binding proteins [BR:nta04031]     107823953 Membrane trafficking [BR:nta04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     107823953 Exosome [BR:nta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107823953   Exosomal proteins of other body fluids (saliva and urine)    107823953   Exosomal proteins of colorectal cancer cells    107823953   Exosomal proteins of bladder cancer cells    107823953 GTP-binding proteins [BR:nta04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     107823953 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase cobW AAA_16 ATP_bind_1 AAA_22 Septin PduV-EutP AAA_7 nSTAND3 AAA_24 NACHT NTPase_1 AAA_5 Sigma54_activat nSTAND1 MCM Motif Other DBs NCBI-GeneID:  107823953 NCBI-ProteinID:  XP_016506150 LinkDB All DBs Position Un AA seq 184 aa AA seqDB search MSMRRRTLLKVIVLGDSGVGKTSLMNRYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMRSFDNLDNWHEEFLKQANPPDPKTFPF ILLGNKIDIDGGNSRVVSEKKAKEWCSSKGIPYFETSAKEDINVDAAFLSIAKTALANEH EQDM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgtctatgcgtagacgaactttgctcaaagtcatcgtcctcggcgacagtggggttggt aaaacatcattgatgaatcgatatgtacacaagaaattcagtcagcaatataaagctaca attggagctgattttgtgacaaaggagcttcaaattgatgacaggctcgtaactcttcaa atatgggatacagcgggccaggagaggtttcagagtcttggggttgcattttatagagga gcagattgttgtgttttggtctatgatgtcaatgtaatgcgatcgtttgacaaccttgac aactggcatgaagagtttctcaaacaggctaacccaccagaccctaagacatttcctttc atattgctgggaaacaagattgatatagatggcggaaatagccgagtggtttctgagaag aaagcaaaggagtggtgttcttcaaaagggataccttactttgagacatcagcaaaagag gatataaatgttgatgccgccttcttgtctattgcaaaaactgctttggccaatgagcac gagcaggatatgtga

DBGET integrated database retrieval system