Nicotiana tabacum (common tobacco): 107827355 Help Entry 107827355         CDS       T04643                                  Symbol NtCaM11 Name (RefSeq) calmodulin-7   KO K02183   calmodulin Organism nta  Nicotiana tabacum (common tobacco) Pathway nta04016   MAPK signaling pathway - plant nta04070   Phosphatidylinositol signaling system nta04075   Plant hormone signal transduction nta04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:nta00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     107827355 (NtCaM11)    04070 Phosphatidylinositol signaling system     107827355 (NtCaM11)    04075 Plant hormone signal transduction     107827355 (NtCaM11)  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     107827355 (NtCaM11)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:nta01009]     107827355 (NtCaM11)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nta04131]     107827355 (NtCaM11)    03036 Chromosome and associated proteins [BR:nta03036]     107827355 (NtCaM11)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nta04147]     107827355 (NtCaM11) Protein phosphatases and associated proteins [BR:nta01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      107827355 (NtCaM11) Membrane trafficking [BR:nta04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     107827355 (NtCaM11) Chromosome and associated proteins [BR:nta03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      107827355 (NtCaM11) Exosome [BR:nta04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    107827355 (NtCaM11) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like Fe_hyd_lg_C DUF6279 PhageMin_Tail MecA_N Motif Other DBs NCBI-GeneID:  107827355 NCBI-ProteinID:  XP_016509951 UniProt:  Q76MF3 LinkDB All DBs Position Un AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagatcagctcacagatgatcagatctctgaattcaaagaagctttcagccttttc gataaggatggagatggttgcatcaccactaaggagcttgggacagtgatgcggtcgttg ggacaaaatccaactgaggctgagcttcaagacatgatcaatgaagtagatgctgatgga aatggaaccattgatttcccggagttccttaacctgatggctcgcaagatgaaagacact gattctgaggaggagctcaaggaagctttcagagtgttcgacaaggatcagaacggattt atttctgcagccgagctgcgccatgtcatgacaaacctaggcgagaagcttactgatgaa gaagttgatgagatgattcgtgaagctgatgtggatggtgatggccagatcaactatgag gagttcgtcaaagtcatgatggccaagtga

DBGET integrated database retrieval system