Neurospora tetrasperma: NEUTE1DRAFT116888 Help Entry NEUTE1DRAFT116888 CDS       T03451                                  Symbol NEUTE1DRAFT_116888 Name (RefSeq) ring-box 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism nte  Neurospora tetrasperma Pathway nte03420   Nucleotide excision repair nte04111   Cell cycle - yeast nte04120   Ubiquitin mediated proteolysis nte04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nte00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     NEUTE1DRAFT116888 (NEUTE1DRAFT_116888)    04120 Ubiquitin mediated proteolysis     NEUTE1DRAFT116888 (NEUTE1DRAFT_116888)   09124 Replication and repair    03420 Nucleotide excision repair     NEUTE1DRAFT116888 (NEUTE1DRAFT_116888)  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     NEUTE1DRAFT116888 (NEUTE1DRAFT_116888)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:nte04121]     NEUTE1DRAFT116888 (NEUTE1DRAFT_116888)    03400 DNA repair and recombination proteins [BR:nte03400]     NEUTE1DRAFT116888 (NEUTE1DRAFT_116888) Enzymes [BR:nte01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      NEUTE1DRAFT116888 (NEUTE1DRAFT_116888) Ubiquitin system [BR:nte04121]  Ubiquitin ligases (E3)   UBL E3 ligases    NEUTE1DRAFT116888 (NEUTE1DRAFT_116888)   Multi subunit type E3    SCF complex     Ring finger protein      NEUTE1DRAFT116888 (NEUTE1DRAFT_116888)    Cul2 complex      NEUTE1DRAFT116888 (NEUTE1DRAFT_116888)    Cul3 complex      NEUTE1DRAFT116888 (NEUTE1DRAFT_116888)    Cul4 complex      NEUTE1DRAFT116888 (NEUTE1DRAFT_116888)    Cul7 complex      NEUTE1DRAFT116888 (NEUTE1DRAFT_116888)    Cul8 complex      NEUTE1DRAFT116888 (NEUTE1DRAFT_116888)    Cul9 complex      NEUTE1DRAFT116888 (NEUTE1DRAFT_116888) DNA repair and recombination proteins [BR:nte03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       NEUTE1DRAFT116888 (NEUTE1DRAFT_116888)     TCR (transcription coupled repair) factors      Cul4-CSA complex       NEUTE1DRAFT116888 (NEUTE1DRAFT_116888) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 PHD_NSD Motif Other DBs NCBI-GeneID:  20823152 NCBI-ProteinID:  XP_009850727 JGI:  Neute_matA2_116888 UniProt:  F8MLQ9 LinkDB All DBs Position Unknown AA seq 121 aa AA seqDB search MADVDMTDAPASAPVVKKNTAAESKGKKADGKPRFEVKKWNAVALWAWDIVVDNCAICRN HIMDLCIECQANQSSATSEECTVAWGICNHAFHFHCISRWLKARQVCPLDNRDWEFQKYG R NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggcggatgtcgatatgacggacgccccggcctctgcgcccgttgtcaagaagaacacg gccgccgagagcaaggggaagaaagcagatggcaagcctcggttcgaggtcaagaagtgg aacgcggtggccctttgggcttgggatattgtcgttgacaactgtgccatctgtcgaaac catataatggatttgtgtattgagtgccaggccaaccagtcatcggccacctcagaagaa tgcacagttgcgtggggtatttgcaatcatgcgttccatttccattgcatctcgagatgg cttaaggcgcgtcaagtttgccctctcgataacagagactgggagttccagaaatacggc cgttga

DBGET integrated database retrieval system