Nicotiana tomentosiformis: 104104527 Help Entry 104104527         CDS       T05025                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism nto  Nicotiana tomentosiformis Pathway nto03420   Nucleotide excision repair nto04120   Ubiquitin mediated proteolysis nto04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nto00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104104527    04120 Ubiquitin mediated proteolysis     104104527   09124 Replication and repair    03420 Nucleotide excision repair     104104527  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:nto04121]     104104527    03400 DNA repair and recombination proteins [BR:nto03400]     104104527 Enzymes [BR:nto01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      104104527 Ubiquitin system [BR:nto04121]  Ubiquitin ligases (E3)   UBL E3 ligases    104104527   Multi subunit type E3    SCF complex     Ring finger protein      104104527    Cul2 complex      104104527    Cul3 complex      104104527    Cul4 complex      104104527    Cul7 complex      104104527    Cul8 complex      104104527    Cul9 complex      104104527 DNA repair and recombination proteins [BR:nto03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       104104527     TCR (transcription coupled repair) factors      Cul4-CSA complex       104104527 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  104104527 NCBI-ProteinID:  XP_009610929 LinkDB All DBs Position 3:complement(150054962..150062565) Genome browser AA seq 123 aa AA seqDB search MDTDVEMVPTGEEFNAAAAAPSSASAASSSTKKPKRFEIKKWNAVALWAWDIVVDNCAIC RNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQK YGH NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggatacagacgtcgagatggttccgactggtgaagaattcaacgctgcagcagcagca ccttcatcagcatctgctgcttcttcttccactaagaaacctaaacgttttgaaatcaaa aagtggaacgctgtcgctctttgggcttgggatattgtagtagacaactgtgctatttgt aggaatcatattatggatctatgcatcgagtgtcaggctaatcaagctagtgctacgagt gaggagtgcactgttgcttggggtgtatgtaaccatgccttccacttccactgcatcagt cgctggctcaaaacccgtcaagtgtgcccattagataatagtgagtgggaatttcagaag tatggtcactag

DBGET integrated database retrieval system