Nicotiana tomentosiformis: 104120680 Help Entry 104120680         CDS       T05025                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism nto  Nicotiana tomentosiformis Pathway nto03420   Nucleotide excision repair nto04120   Ubiquitin mediated proteolysis nto04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nto00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104120680    04120 Ubiquitin mediated proteolysis     104120680   09124 Replication and repair    03420 Nucleotide excision repair     104120680  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:nto04121]     104120680    03400 DNA repair and recombination proteins [BR:nto03400]     104120680 Enzymes [BR:nto01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      104120680 Ubiquitin system [BR:nto04121]  Ubiquitin ligases (E3)   UBL E3 ligases    104120680   Multi subunit type E3    SCF complex     Ring finger protein      104120680    Cul2 complex      104120680    Cul3 complex      104120680    Cul4 complex      104120680    Cul7 complex      104120680    Cul8 complex      104120680    Cul9 complex      104120680 DNA repair and recombination proteins [BR:nto03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       104120680     TCR (transcription coupled repair) factors      Cul4-CSA complex       104120680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_16 zf-RING_11 Motif Other DBs NCBI-GeneID:  104120680 NCBI-ProteinID:  XP_070034310 LinkDB All DBs Position 6:12321037..12327826 Genome browser AA seq 132 aa AA seqDB search MASPDTDVPMVLAGEGSTGVGSSTKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLGKLYDAVFEYKCHYSM LHPKYMYDDCSI NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atggcatcaccggacaccgacgtacctatggttctcgccggcgagggttcaaccggcgtt ggatcgtccactaaaaagcccaagcgatttgaaatcaaaaagtggaatgctgttgctctc tgggcttgggatattgtggtagataattgtgcaatctgtaggaatcacatcatggatctg tgtatcgagtgtcaagctaatcaagctagcgcgacaagtgaggaatgtacagttgcatgg ggtgtttgcaaccatgcattccacttccattgcattagtcggtggctcaagactcgtcaa gtgtgtccacttggtaagttgtatgatgctgtctttgaatacaaatgccactatagtatg ttacatcctaagtatatgtatgatgattgttctatctga

DBGET integrated database retrieval system