Nasonia vitripennis (jewel wasp): 100118704 Help Entry 100118704         CDS       T01081                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism nvi  Nasonia vitripennis (jewel wasp) Pathway nvi00510   N-Glycan biosynthesis nvi00513   Various types of N-glycan biosynthesis nvi04141   Protein processing in endoplasmic reticulum Module nvi_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:nvi00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     100118704    00513 Various types of N-glycan biosynthesis     100118704  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100118704 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 CAAD Pestivirus_E2 Pox_E2-like Motif Other DBs NCBI-GeneID:  100118704 NCBI-ProteinID:  XP_001600065 NASONIABASE:  NV16811 UniProt:  A0A7M7HE02 LinkDB All DBs Position 1:15134849..15136920 Genome browser AA seq 81 aa AA seqDB search MMLEIESMARYVSPINPTVFPLLALVLLGIGIFFTAWFFVYEVTSTKFTRDIFKELVISL VAAIFSGFGVLFLLLWVGIYV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgatgctggagatcgaatctatggccagatatgtctcgccaatcaaccccacagtcttt cctctactggcactcgtattgctgggtattggaatcttcttcactgcttggtttttcgtt tacgaagtcaccagcacaaagttcacgagggacatattcaaggagttggtgatctccctg gtggcagcgatattctctggctttggtgttctgttcctcttgttatgggtcggcatttat gtttag

DBGET integrated database retrieval system