Neogale vison (American mink): 122901601 Help Entry 122901601         CDS       T08764                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism nvs  Neogale vison (American mink) Pathway nvs04060   Cytokine-cytokine receptor interaction nvs04151   PI3K-Akt signaling pathway nvs04630   JAK-STAT signaling pathway nvs04640   Hematopoietic cell lineage nvs04657   IL-17 signaling pathway nvs04658   Th1 and Th2 cell differentiation nvs04659   Th17 cell differentiation nvs04660   T cell receptor signaling pathway nvs04664   Fc epsilon RI signaling pathway nvs04672   Intestinal immune network for IgA production nvs05140   Leishmaniasis nvs05200   Pathways in cancer nvs05310   Asthma nvs05320   Autoimmune thyroid disease nvs05321   Inflammatory bowel disease nvs05330   Allograft rejection Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     122901601 (IL4)    04151 PI3K-Akt signaling pathway     122901601 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122901601 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     122901601 (IL4)    04660 T cell receptor signaling pathway     122901601 (IL4)    04658 Th1 and Th2 cell differentiation     122901601 (IL4)    04659 Th17 cell differentiation     122901601 (IL4)    04657 IL-17 signaling pathway     122901601 (IL4)    04664 Fc epsilon RI signaling pathway     122901601 (IL4)    04672 Intestinal immune network for IgA production     122901601 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122901601 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     122901601 (IL4)   09163 Immune disease    05310 Asthma     122901601 (IL4)    05320 Autoimmune thyroid disease     122901601 (IL4)    05321 Inflammatory bowel disease     122901601 (IL4)    05330 Allograft rejection     122901601 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:nvs04052]     122901601 (IL4)    00536 Glycosaminoglycan binding proteins [BR:nvs00536]     122901601 (IL4) Cytokines and neuropeptides [BR:nvs04052]  Cytokines   Interleukins    122901601 (IL4) Glycosaminoglycan binding proteins [BR:nvs00536]  Heparan sulfate / Heparin   Cytokines    122901601 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 DUF4381 Motif Other DBs NCBI-GeneID:  122901601 NCBI-ProteinID:  XP_044096744 UniProt:  A0A8C7BJW3 LinkDB All DBs Position 1:complement(245835981..245844415) Genome browser AA seq 132 aa AA seqDB search MGLTSQLIPTLVCLLALTGTFIHGHNFSIAIKEIIKTLNILTARNDSCMELTVTEVFTAP KNTSEKEIFCRAATVLQQLSTHNCSNRLLRGLHRNLRNMANMTCSVNEVKKSTLKDFLER LKVIMQQKYYRH NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccaactgattccaactctggtctgcttactagcactcaccggcact ttcatccacggacataacttcagtattgccattaaggagatcatcaaaacgttgaacatc ctcacagcgagaaacgactcatgcatggagctgaccgtcaccgaagtcttcactgcccca aagaacacaagtgagaaggaaatcttctgcagagctgcaactgtgcttcagcagctctct acacacaattgctccaacagattgctcagaggacttcacaggaacctcaggaacatggca aacatgacctgttcggtgaatgaagtcaagaagagtacactgaaagacttcttggaaagg ctaaaagtgatcatgcaacagaaatactacaggcactga

DBGET integrated database retrieval system