Neogale vison (American mink): 122906719 Help Entry 122906719         CDS       T08764                                  Symbol TP53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism nvs  Neogale vison (American mink) Pathway nvs01522   Endocrine resistance nvs01524   Platinum drug resistance nvs04010   MAPK signaling pathway nvs04071   Sphingolipid signaling pathway nvs04110   Cell cycle nvs04115   p53 signaling pathway nvs04137   Mitophagy - animal nvs04151   PI3K-Akt signaling pathway nvs04210   Apoptosis nvs04211   Longevity regulating pathway nvs04216   Ferroptosis nvs04218   Cellular senescence nvs04310   Wnt signaling pathway nvs04722   Neurotrophin signaling pathway nvs04919   Thyroid hormone signaling pathway nvs05012   Parkinson disease nvs05014   Amyotrophic lateral sclerosis nvs05016   Huntington disease nvs05160   Hepatitis C nvs05161   Hepatitis B nvs05162   Measles nvs05163   Human cytomegalovirus infection nvs05165   Human papillomavirus infection nvs05166   Human T-cell leukemia virus 1 infection nvs05167   Kaposi sarcoma-associated herpesvirus infection nvs05168   Herpes simplex virus 1 infection nvs05169   Epstein-Barr virus infection nvs05200   Pathways in cancer nvs05202   Transcriptional misregulation in cancer nvs05203   Viral carcinogenesis nvs05205   Proteoglycans in cancer nvs05206   MicroRNAs in cancer nvs05210   Colorectal cancer nvs05212   Pancreatic cancer nvs05213   Endometrial cancer nvs05214   Glioma nvs05215   Prostate cancer nvs05216   Thyroid cancer nvs05217   Basal cell carcinoma nvs05218   Melanoma nvs05219   Bladder cancer nvs05220   Chronic myeloid leukemia nvs05222   Small cell lung cancer nvs05223   Non-small cell lung cancer nvs05224   Breast cancer nvs05225   Hepatocellular carcinoma nvs05226   Gastric cancer nvs05230   Central carbon metabolism in cancer nvs05417   Lipid and atherosclerosis nvs05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122906719 (TP53)    04310 Wnt signaling pathway     122906719 (TP53)    04071 Sphingolipid signaling pathway     122906719 (TP53)    04151 PI3K-Akt signaling pathway     122906719 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     122906719 (TP53)   09143 Cell growth and death    04110 Cell cycle     122906719 (TP53)    04210 Apoptosis     122906719 (TP53)    04216 Ferroptosis     122906719 (TP53)    04115 p53 signaling pathway     122906719 (TP53)    04218 Cellular senescence     122906719 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     122906719 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     122906719 (TP53)   09149 Aging    04211 Longevity regulating pathway     122906719 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122906719 (TP53)    05202 Transcriptional misregulation in cancer     122906719 (TP53)    05206 MicroRNAs in cancer     122906719 (TP53)    05205 Proteoglycans in cancer     122906719 (TP53)    05203 Viral carcinogenesis     122906719 (TP53)    05230 Central carbon metabolism in cancer     122906719 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     122906719 (TP53)    05212 Pancreatic cancer     122906719 (TP53)    05225 Hepatocellular carcinoma     122906719 (TP53)    05226 Gastric cancer     122906719 (TP53)    05214 Glioma     122906719 (TP53)    05216 Thyroid cancer     122906719 (TP53)    05220 Chronic myeloid leukemia     122906719 (TP53)    05217 Basal cell carcinoma     122906719 (TP53)    05218 Melanoma     122906719 (TP53)    05219 Bladder cancer     122906719 (TP53)    05215 Prostate cancer     122906719 (TP53)    05213 Endometrial cancer     122906719 (TP53)    05224 Breast cancer     122906719 (TP53)    05222 Small cell lung cancer     122906719 (TP53)    05223 Non-small cell lung cancer     122906719 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     122906719 (TP53)    05161 Hepatitis B     122906719 (TP53)    05160 Hepatitis C     122906719 (TP53)    05162 Measles     122906719 (TP53)    05168 Herpes simplex virus 1 infection     122906719 (TP53)    05163 Human cytomegalovirus infection     122906719 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     122906719 (TP53)    05169 Epstein-Barr virus infection     122906719 (TP53)    05165 Human papillomavirus infection     122906719 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     122906719 (TP53)    05014 Amyotrophic lateral sclerosis     122906719 (TP53)    05016 Huntington disease     122906719 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122906719 (TP53)    05418 Fluid shear stress and atherosclerosis     122906719 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     122906719 (TP53)    01522 Endocrine resistance     122906719 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:nvs03000]     122906719 (TP53)    03036 Chromosome and associated proteins [BR:nvs03036]     122906719 (TP53)    03400 DNA repair and recombination proteins [BR:nvs03400]     122906719 (TP53) Transcription factors [BR:nvs03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     122906719 (TP53) Chromosome and associated proteins [BR:nvs03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      122906719 (TP53) DNA repair and recombination proteins [BR:nvs03400]  Eukaryotic type   Check point factors    Other check point factors     122906719 (TP53) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  P53 P53_tetramer P53_TAD Motif Other DBs NCBI-GeneID:  122906719 NCBI-ProteinID:  XP_044104937 UniProt:  A0A8C7A9R2 LinkDB All DBs Position 5:complement(56662399..56676055) Genome browser AA seq 379 aa AA seqDB search MQDPQSELTIDPPLSQETFSELWNLLPENNVLSSELSPAVDELLSEGVNWLGEGSNDAPR MPATPVPAAPGPAPSWPLSSFVPSPKTYPGAYGFRLGFLHSGTAKSVTCTYSPSLNKLFC QLAKTCPVQLWVSSPPPADTCVRAMAIYKKSEFVTEVVRRCPHHERCSDSSDGLAPPQHL IRVEGNLRAKYLDDRNTFRQSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTI ITLEDSSGNVLGRSSFEVRVCACPGRDRRTEEENFRKKGEPCPEPPPGSTKRALPPSTSS SPPQKKKPLDGEYFTLQIRGLERYNMFRELNEALELKDALNGKEPGGSRPHSSHLKAKKG QSTSRHKKPMLKREGPDSD NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt atgcaggacccacagtccgagctcaccatcgacccccctctaagccaggagacattttcc gaattgtggaacctgcttcctgaaaacaatgttctgtcttctgagctgtcccctgcagtg gatgaactgctgtcagaaggtgtgaactggctgggagaagggtccaatgacgctcccagg atgccggcgactcctgtgcccgcagcccccggacccgccccctcctggcccctgtcatct tttgtcccttccccgaagacctaccctggcgcctatgggttccgtctggggttcctgcat tccgggacagccaagtctgttacttgcacgtactccccctccctcaacaaactgttctgc cagctggcaaagacctgccccgtgcagctgtgggtcagctcgccacccccagccgacacc tgcgtccgggccatggccatttacaagaagtcggagtttgtgacggaagtggtgcggcgc tgcccccaccatgagcgctgctcagacagtagtgatggtctggccccgcctcagcatctc atccgggtagagggaaacctgcgggccaagtacctggacgacaggaacaccttccggcag agcgtggtggtgccctacgagccgcccgaggtgggctccgactgcaccaccatccactat aactacatgtgtaacagttcctgcatggggggcatgaaccgccggcccatcctcaccatc atcactctggaagattccagtggtaatgtgctgggacggagcagcttcgaggtacgcgtc tgtgcctgtcccgggagagaccggcgcacagaggaggaaaatttccgcaagaagggggag ccttgccctgagccgccccccgggagcaccaagcgagcactgcctcccagcaccagctcg tctcccccgcaaaagaaaaagccgctggatggggagtacttcacccttcagatccgtggc cttgaacgctacaacatgttcagggagttgaatgaggccttggagctgaaggatgccctg aacggaaaggagccagggggaagcaggcctcactccagccacctgaaggctaagaagggg cagtctacctcccgccataaaaaaccgatgctgaagagagaggggcccgactcagactga

DBGET integrated database retrieval system