Neogale vison (American mink): 122912989 Help Entry 122912989         CDS       T08764                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism nvs  Neogale vison (American mink) Pathway nvs00510   N-Glycan biosynthesis nvs00513   Various types of N-glycan biosynthesis nvs04141   Protein processing in endoplasmic reticulum Module nvs_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:nvs00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     122912989 (TMEM258)    00513 Various types of N-glycan biosynthesis     122912989 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     122912989 (TMEM258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  122912989 NCBI-ProteinID:  XP_044115370 UniProt:  A0A8C7C6M5 LinkDB All DBs Position 7:complement(197524634..197527754) Genome browser AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctagaggccatgagcagatacaccagcccagtgaaccctgctgtcttccctcat ctgaccgtggtgctgttggccattggcatgttctttacggcctggttcttcgtttatgag gttacctccaccaaatacactcgggatatctacaaagagctcctcatctccttggtggcc tcgctcttcatgggttttggagtcctcttcctgctgctctgggttggcatctacgtatga

DBGET integrated database retrieval system