Neogale vison (American mink): 122913121 Help Entry 122913121         CDS       T08764                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism nvs  Neogale vison (American mink) Pathway nvs01523   Antifolate resistance nvs04010   MAPK signaling pathway nvs04014   Ras signaling pathway nvs04024   cAMP signaling pathway nvs04062   Chemokine signaling pathway nvs04064   NF-kappa B signaling pathway nvs04066   HIF-1 signaling pathway nvs04071   Sphingolipid signaling pathway nvs04137   Mitophagy - animal nvs04151   PI3K-Akt signaling pathway nvs04210   Apoptosis nvs04211   Longevity regulating pathway nvs04218   Cellular senescence nvs04380   Osteoclast differentiation nvs04613   Neutrophil extracellular trap formation nvs04620   Toll-like receptor signaling pathway nvs04621   NOD-like receptor signaling pathway nvs04622   RIG-I-like receptor signaling pathway nvs04623   Cytosolic DNA-sensing pathway nvs04625   C-type lectin receptor signaling pathway nvs04657   IL-17 signaling pathway nvs04658   Th1 and Th2 cell differentiation nvs04659   Th17 cell differentiation nvs04660   T cell receptor signaling pathway nvs04662   B cell receptor signaling pathway nvs04668   TNF signaling pathway nvs04722   Neurotrophin signaling pathway nvs04917   Prolactin signaling pathway nvs04920   Adipocytokine signaling pathway nvs04926   Relaxin signaling pathway nvs04931   Insulin resistance nvs04932   Non-alcoholic fatty liver disease nvs04933   AGE-RAGE signaling pathway in diabetic complications nvs04936   Alcoholic liver disease nvs05010   Alzheimer disease nvs05022   Pathways of neurodegeneration - multiple diseases nvs05030   Cocaine addiction nvs05132   Salmonella infection nvs05133   Pertussis nvs05134   Legionellosis nvs05135   Yersinia infection nvs05140   Leishmaniasis nvs05142   Chagas disease nvs05145   Toxoplasmosis nvs05146   Amoebiasis nvs05152   Tuberculosis nvs05160   Hepatitis C nvs05161   Hepatitis B nvs05162   Measles nvs05163   Human cytomegalovirus infection nvs05164   Influenza A nvs05165   Human papillomavirus infection nvs05166   Human T-cell leukemia virus 1 infection nvs05167   Kaposi sarcoma-associated herpesvirus infection nvs05168   Herpes simplex virus 1 infection nvs05169   Epstein-Barr virus infection nvs05170   Human immunodeficiency virus 1 infection nvs05171   Coronavirus disease - COVID-19 nvs05200   Pathways in cancer nvs05202   Transcriptional misregulation in cancer nvs05203   Viral carcinogenesis nvs05207   Chemical carcinogenesis - receptor activation nvs05208   Chemical carcinogenesis - reactive oxygen species nvs05212   Pancreatic cancer nvs05215   Prostate cancer nvs05220   Chronic myeloid leukemia nvs05221   Acute myeloid leukemia nvs05222   Small cell lung cancer nvs05235   PD-L1 expression and PD-1 checkpoint pathway in cancer nvs05321   Inflammatory bowel disease nvs05415   Diabetic cardiomyopathy nvs05417   Lipid and atherosclerosis nvs05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122913121 (RELA)    04014 Ras signaling pathway     122913121 (RELA)    04064 NF-kappa B signaling pathway     122913121 (RELA)    04668 TNF signaling pathway     122913121 (RELA)    04066 HIF-1 signaling pathway     122913121 (RELA)    04071 Sphingolipid signaling pathway     122913121 (RELA)    04024 cAMP signaling pathway     122913121 (RELA)    04151 PI3K-Akt signaling pathway     122913121 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     122913121 (RELA)   09143 Cell growth and death    04210 Apoptosis     122913121 (RELA)    04218 Cellular senescence     122913121 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     122913121 (RELA)    04620 Toll-like receptor signaling pathway     122913121 (RELA)    04621 NOD-like receptor signaling pathway     122913121 (RELA)    04622 RIG-I-like receptor signaling pathway     122913121 (RELA)    04623 Cytosolic DNA-sensing pathway     122913121 (RELA)    04625 C-type lectin receptor signaling pathway     122913121 (RELA)    04660 T cell receptor signaling pathway     122913121 (RELA)    04658 Th1 and Th2 cell differentiation     122913121 (RELA)    04659 Th17 cell differentiation     122913121 (RELA)    04657 IL-17 signaling pathway     122913121 (RELA)    04662 B cell receptor signaling pathway     122913121 (RELA)    04062 Chemokine signaling pathway     122913121 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     122913121 (RELA)    04917 Prolactin signaling pathway     122913121 (RELA)    04926 Relaxin signaling pathway     122913121 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     122913121 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     122913121 (RELA)   09149 Aging    04211 Longevity regulating pathway     122913121 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122913121 (RELA)    05202 Transcriptional misregulation in cancer     122913121 (RELA)    05207 Chemical carcinogenesis - receptor activation     122913121 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     122913121 (RELA)    05203 Viral carcinogenesis     122913121 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     122913121 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     122913121 (RELA)    05221 Acute myeloid leukemia     122913121 (RELA)    05220 Chronic myeloid leukemia     122913121 (RELA)    05215 Prostate cancer     122913121 (RELA)    05222 Small cell lung cancer     122913121 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     122913121 (RELA)    05170 Human immunodeficiency virus 1 infection     122913121 (RELA)    05161 Hepatitis B     122913121 (RELA)    05160 Hepatitis C     122913121 (RELA)    05171 Coronavirus disease - COVID-19     122913121 (RELA)    05164 Influenza A     122913121 (RELA)    05162 Measles     122913121 (RELA)    05168 Herpes simplex virus 1 infection     122913121 (RELA)    05163 Human cytomegalovirus infection     122913121 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     122913121 (RELA)    05169 Epstein-Barr virus infection     122913121 (RELA)    05165 Human papillomavirus infection     122913121 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     122913121 (RELA)    05135 Yersinia infection     122913121 (RELA)    05133 Pertussis     122913121 (RELA)    05134 Legionellosis     122913121 (RELA)    05152 Tuberculosis     122913121 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     122913121 (RELA)    05145 Toxoplasmosis     122913121 (RELA)    05140 Leishmaniasis     122913121 (RELA)    05142 Chagas disease     122913121 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     122913121 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     122913121 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     122913121 (RELA)   09165 Substance dependence    05030 Cocaine addiction     122913121 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122913121 (RELA)    05418 Fluid shear stress and atherosclerosis     122913121 (RELA)    05415 Diabetic cardiomyopathy     122913121 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     122913121 (RELA)    04932 Non-alcoholic fatty liver disease     122913121 (RELA)    04931 Insulin resistance     122913121 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     122913121 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     122913121 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:nvs03000]     122913121 (RELA) Transcription factors [BR:nvs03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     122913121 (RELA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  122913121 NCBI-ProteinID:  XP_044115623 LinkDB All DBs Position 7:complement(200572235..200580920) Genome browser AA seq 544 aa AA seqDB search MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSTTSVPKPAPQPYPFTPSLSTINF EEFSPMVFPSGQIPNQTPALAPAPAPILAPAPVPAPAPAPAPILAPPGLAQPVAPPAPKT AQAGEGTLSEALLQLQFDADEDLGALLGSSADPAVFTDLACVDNSEFQQLLNQGVSAAPH TAEPMLMEYPEAITRLVTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSSIADMDFSALLS QISS NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt atggacgacctgtttcccctcatcttcccgtctgagcctgcgcaggcctctggcccctat gtggagatcatcgagcagcccaagcagcggggaatgcgcttccgctacaagtgcgagggc cgctcggcgggcagtatcccaggcgagaggagcacggataccaccaagacccatcccacc atcaagatcaatggctacactgggccggggacggttcgcatctctctggtcaccaaagac ccccctcaccggcctcacccccatgagcttgtggggaaagactgccgggatggcttctat gaggctgagctctgcccagaccgctgcatccacagcttccagaacctggggatccagtgt gtaaagaagcgggacctggagcaggccatcagtcaacgcatccagaccaataacaatccc ttccaagttcccatagaagaacagcgtggggactatgacctgaacgcagtgcggctctgc ttccaggtgacagtgcgggacccggcaggcaggcccctccgcttgtcacctgtcctctct catcccatttttgacaaccgcgcccccaacaccgctgagctcaagatctgccgggtgaac cggaactccgggagctgcctcggcggggatgagatcttcctgctgtgtgacaaggtgcag aaagaggacattgaagtgtatttcacgggaccaggctgggaggcccgaggctccttttca caagctgacgtccaccgacaagtggccattgtgttccggacacctccctacgcggacccc agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc agtgagcccatggagttccagtacttgccagacacagatgatcgtcaccggattgaggag aaacgcaaaaggacatacgagaccttcaagagcatcatgaaaaaaagtcccttcaatgga cccactgaccccaggcctccaccccggcgcattgcggtgccttcccgaagcacaacttcc gtccccaagccagctccccagccctatccctttacgccatccctcagcaccatcaacttc gaggagttctcccccatggtctttccttcggggcagattccaaaccagacccctgccttg gcaccggcccctgccccaatcctggccccggccccggtcccagccccggctccagccccg gccccaatcttagcccccccgggcctcgctcagcctgtggccccccccgcccccaagacc gcccaggctggggaagggacgctgtcggaggccttgctacagctgcaatttgacgctgac gaagacctgggggccctgctgggcagcagcgctgaccctgccgtgttcacagacctggca tgcgtcgacaactcagagtttcagcagctgctgaaccaaggtgtatctgcggccccacac acagccgagcccatgctgatggagtaccctgaggcaataactcgcctggtgacagggtcc cagaggccccccgacccagctcctgctcccctgggggcctctgggctccccaacggcctc ctctcaggggatgaagacttctcctccatcgcagacatggacttctcagccctcctgagt cagatcagctcctaa

DBGET integrated database retrieval system