Neogale vison (American mink): 122916938 Help Entry 122916938         CDS       T08764                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism nvs  Neogale vison (American mink) Pathway nvs04060   Cytokine-cytokine receptor interaction nvs04151   PI3K-Akt signaling pathway nvs04217   Necroptosis nvs04380   Osteoclast differentiation nvs04620   Toll-like receptor signaling pathway nvs04621   NOD-like receptor signaling pathway nvs04622   RIG-I-like receptor signaling pathway nvs04623   Cytosolic DNA-sensing pathway nvs04630   JAK-STAT signaling pathway nvs04650   Natural killer cell mediated cytotoxicity nvs04668   TNF signaling pathway nvs04936   Alcoholic liver disease nvs05135   Yersinia infection nvs05142   Chagas disease nvs05152   Tuberculosis nvs05160   Hepatitis C nvs05161   Hepatitis B nvs05162   Measles nvs05163   Human cytomegalovirus infection nvs05164   Influenza A nvs05165   Human papillomavirus infection nvs05167   Kaposi sarcoma-associated herpesvirus infection nvs05168   Herpes simplex virus 1 infection nvs05169   Epstein-Barr virus infection nvs05170   Human immunodeficiency virus 1 infection nvs05171   Coronavirus disease - COVID-19 nvs05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     122916938 (IFNB1)    04668 TNF signaling pathway     122916938 (IFNB1)    04151 PI3K-Akt signaling pathway     122916938 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122916938 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     122916938 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122916938 (IFNB1)    04621 NOD-like receptor signaling pathway     122916938 (IFNB1)    04622 RIG-I-like receptor signaling pathway     122916938 (IFNB1)    04623 Cytosolic DNA-sensing pathway     122916938 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     122916938 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     122916938 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     122916938 (IFNB1)    05161 Hepatitis B     122916938 (IFNB1)    05160 Hepatitis C     122916938 (IFNB1)    05171 Coronavirus disease - COVID-19     122916938 (IFNB1)    05164 Influenza A     122916938 (IFNB1)    05162 Measles     122916938 (IFNB1)    05168 Herpes simplex virus 1 infection     122916938 (IFNB1)    05163 Human cytomegalovirus infection     122916938 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     122916938 (IFNB1)    05169 Epstein-Barr virus infection     122916938 (IFNB1)    05165 Human papillomavirus infection     122916938 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     122916938 (IFNB1)    05152 Tuberculosis     122916938 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     122916938 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122916938 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     122916938 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:nvs04052]     122916938 (IFNB1) Cytokines and neuropeptides [BR:nvs04052]  Cytokines   Interferons    122916938 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  122916938 NCBI-ProteinID:  XP_044120260 UniProt:  A0A8C7AYN9 LinkDB All DBs Position 9:47874063..47874623 Genome browser AA seq 186 aa AA seqDB search MTSRYILQTALLVYFSTTVLAMNYNLLRFQLSSSSVECQELLLQLNGTSKDCLKDRMNFK IPEEIQKSQKFQKEDIVLVTLEMFQKTSDIFRRNLSSMGWNESIVENLLATLHWQKEHLE EILEDIMQEENFTWDHRTLLHLKRYYLRIVRYLKAKEFSVCAWTIVQAEILKSFFFLDKL IDSLPN NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccagcaggtatatcctccaaactgctctcctggtatatttctccaccacggttctt gccatgaactataacttacttcgattccaactaagcagcagcagtgtggagtgccaggag ctccttctacagctgaatggaacttctaaagattgcctcaaggacaggatgaacttcaag atccctgaggagatccagaaatcccagaagttccagaaggaggacatcgtattggtcacc cttgagatgttccagaagacctctgatattttcaggagaaatctctcaagcatgggatgg aatgagagcattgtcgagaacctccttgccacactccactggcagaaggaacatctggag gaaatcctggaggacatcatgcaggaggaaaacttcacttgggaccacaggacccttctg cacctgaagagatattatctaaggatcgtgcggtacctgaaagccaaggagttcagcgtc tgtgcctggacaatagtgcaagcagaaatcctcaagagctttttcttccttgataaactt atagattctctccctaactga

DBGET integrated database retrieval system