Nematolebias whitei (Rio pearlfish): 119422899 Help Entry 119422899         CDS       T08042                                  Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism nwh  Nematolebias whitei (Rio pearlfish) Pathway nwh04060   Cytokine-cytokine receptor interaction nwh04672   Intestinal immune network for IgA production nwh04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:nwh00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119422899  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     119422899  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     119422899  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:nwh04052]     119422899    00536 Glycosaminoglycan binding proteins [BR:nwh00536]     119422899 Cytokines and neuropeptides [BR:nwh04052]  Cytokines   Chemokines    119422899 Glycosaminoglycan binding proteins [BR:nwh00536]  Heparan sulfate / Heparin   Chemokines    119422899 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  119422899 NCBI-ProteinID:  XP_037546237 LinkDB All DBs Position 16:16389582..16399371 Genome browser AA seq 102 aa AA seqDB search MDVKLLVLMALMAIATHGPTAEAKPISLIERCWCRSTLNTVPQRSIKELKFLHTPNCPFQ VIAKLKSNREVCINPETKWLQQYLKNAVNKVKKSKRRNNQKN NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggacgtgaagctgctggtcctgatggctctgatggccatcgccacacatggtccaacc gcagaggccaagcccatcagtctgatcgagcggtgctggtgtcgctccacgctcaacacc gttcctcagcgctccatcaaggagctcaagtttctacacacaccaaactgccccttccaa gtcattgctaagctgaagagcaacagagaagtttgcatcaacccagagaccaagtggctg cagcagtacttgaagaacgccgtcaacaaggttaaaaagtccaaaagacgcaacaaccag aagaactaa

DBGET integrated database retrieval system