Ornithorhynchus anatinus (platypus): 100075021 Help Entry 100075021         CDS       T01045                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa01522   Endocrine resistance oaa04010   MAPK signaling pathway oaa04024   cAMP signaling pathway oaa04210   Apoptosis oaa04380   Osteoclast differentiation oaa04620   Toll-like receptor signaling pathway oaa04657   IL-17 signaling pathway oaa04658   Th1 and Th2 cell differentiation oaa04659   Th17 cell differentiation oaa04660   T cell receptor signaling pathway oaa04662   B cell receptor signaling pathway oaa04668   TNF signaling pathway oaa04713   Circadian entrainment oaa04725   Cholinergic synapse oaa04728   Dopaminergic synapse oaa04915   Estrogen signaling pathway oaa04917   Prolactin signaling pathway oaa04921   Oxytocin signaling pathway oaa04926   Relaxin signaling pathway oaa04928   Parathyroid hormone synthesis, secretion and action oaa04932   Non-alcoholic fatty liver disease oaa04935   Growth hormone synthesis, secretion and action oaa05031   Amphetamine addiction oaa05132   Salmonella infection oaa05133   Pertussis oaa05135   Yersinia infection oaa05140   Leishmaniasis oaa05142   Chagas disease oaa05161   Hepatitis B oaa05162   Measles oaa05166   Human T-cell leukemia virus 1 infection oaa05167   Kaposi sarcoma-associated herpesvirus infection oaa05170   Human immunodeficiency virus 1 infection oaa05171   Coronavirus disease - COVID-19 oaa05200   Pathways in cancer oaa05207   Chemical carcinogenesis - receptor activation oaa05208   Chemical carcinogenesis - reactive oxygen species oaa05210   Colorectal cancer oaa05224   Breast cancer oaa05231   Choline metabolism in cancer oaa05235   PD-L1 expression and PD-1 checkpoint pathway in cancer oaa05323   Rheumatoid arthritis oaa05417   Lipid and atherosclerosis oaa05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oaa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100075021 (FOS)    04668 TNF signaling pathway     100075021 (FOS)    04024 cAMP signaling pathway     100075021 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100075021 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100075021 (FOS)    04660 T cell receptor signaling pathway     100075021 (FOS)    04658 Th1 and Th2 cell differentiation     100075021 (FOS)    04659 Th17 cell differentiation     100075021 (FOS)    04657 IL-17 signaling pathway     100075021 (FOS)    04662 B cell receptor signaling pathway     100075021 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     100075021 (FOS)    04917 Prolactin signaling pathway     100075021 (FOS)    04921 Oxytocin signaling pathway     100075021 (FOS)    04926 Relaxin signaling pathway     100075021 (FOS)    04935 Growth hormone synthesis, secretion and action     100075021 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     100075021 (FOS)   09156 Nervous system    04725 Cholinergic synapse     100075021 (FOS)    04728 Dopaminergic synapse     100075021 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     100075021 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     100075021 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100075021 (FOS)    05207 Chemical carcinogenesis - receptor activation     100075021 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     100075021 (FOS)    05231 Choline metabolism in cancer     100075021 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100075021 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     100075021 (FOS)    05224 Breast cancer     100075021 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100075021 (FOS)    05170 Human immunodeficiency virus 1 infection     100075021 (FOS)    05161 Hepatitis B     100075021 (FOS)    05171 Coronavirus disease - COVID-19     100075021 (FOS)    05162 Measles     100075021 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     100075021 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     100075021 (FOS)    05135 Yersinia infection     100075021 (FOS)    05133 Pertussis     100075021 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100075021 (FOS)    05142 Chagas disease     100075021 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     100075021 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     100075021 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100075021 (FOS)    05418 Fluid shear stress and atherosclerosis     100075021 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100075021 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100075021 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:oaa03000]     100075021 (FOS)    04131 Membrane trafficking [BR:oaa04131]     100075021 (FOS) Transcription factors [BR:oaa03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     100075021 (FOS) Membrane trafficking [BR:oaa04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     100075021 (FOS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf DUF3450 HALZ Borrelia_orfA Macoilin Motif Other DBs NCBI-GeneID:  100075021 NCBI-ProteinID:  XP_028918155 Ensembl:  ENSOANG00000005064 UniProt:  A0A6I8PM58 LinkDB All DBs Position 1:39135129..39138643 Genome browser AA seq 376 aa AA seqDB search MMYRAFNADYEASSSRCSSASPAGENLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLISSVAPSQTRAHPYGVSAPSTGAYARTGIVKTTGGRGQS IGRRGKIEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTE IANLLKEKEKLEFILAAHRPACKIPDDLGFPEDMAASSLDLSGCLTEAVTPESEEAAFHL PLLQEPEPKTSAEPVKNGSGLELKAEPFDDFLFPPSARGSETARSVPDVDLAGSFYAADW EPLHSGSLGMGAVAELEPLCTPVVTCTPTCTTYTSSFVFTYPEADSFPSCAAAHRKGSSS NEPSSDSLSSPTLLAL NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt atgatgtaccgggccttcaacgccgactacgaggcctcctcctcccgctgcagcagcgct tccccggcgggggagaacctctcctattaccactccccggccgactccttctccagcatg ggctcccctgtcaacgctcaggatttctgcaccgatctggccgtttccagtgccaacttt ataccgacggtgactgccatttcaaccagcccagacctgcagtggctggtccagcccacc ctcatctcttccgtggcgccctcccagacccgagcacatccctatggggtttccgctcct tcgaccggtgcttatgccaggactggcatcgtgaagaccacgggaggcagagggcagagc attggcaggaggggcaaaattgaacagctgtctccagaagaagaggaaaagagaaggatc aggagggaaaggaacaagatggctgcagccaaatgccgaaaccggaggagagagctgact gacaccctccaagcggagacggaccagctggaggacgagaagtccgctctgcagaccgag atcgccaacctgctgaaggagaaggagaaactagagttcatcctggcggcccaccgaccc gcctgcaagatcccagatgacctgggtttcccggaggacatggcagcctcctccctcgac ctcagcggctgcctgacggaagcggtcaccccggagtcggaagaagccgcttttcacctg cccctcttacaggagcccgagcccaagacctccgcggagccggtcaagaacggctccggt ctggagctgaaggccgagcccttcgacgacttcctcttcccgccttcggccaggggctcc gaaaccgcccgctcggtgccggacgtggacctggccggctccttctacgcggcggactgg gagcccctgcacagcggttccctggggatgggcgctgtggccgagctagagcccctgtgc acgcccgtggtcacctgcacccccacctgcaccacgtacacgtcttccttcgtcttcacc taccccgaggccgactccttccccagctgcgccgcggcccaccggaagggcagcagcagc aacgagccctcatctgactcgcttagctctccgaccctgctggctctgtga

DBGET integrated database retrieval system