Ornithorhynchus anatinus (platypus): 100085356 Help Entry 100085356         CDS       T01045                                  Symbol ACTL8 Name (RefSeq) actin-like protein 8   KO K05692   actin beta/gamma 1 Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa03082   ATP-dependent chromatin remodeling oaa04015   Rap1 signaling pathway oaa04145   Phagosome oaa04210   Apoptosis oaa04390   Hippo signaling pathway oaa04510   Focal adhesion oaa04520   Adherens junction oaa04530   Tight junction oaa04611   Platelet activation oaa04613   Neutrophil extracellular trap formation oaa04670   Leukocyte transendothelial migration oaa04714   Thermogenesis oaa04810   Regulation of actin cytoskeleton oaa04814   Motor proteins oaa04820   Cytoskeleton in muscle cells oaa04919   Thyroid hormone signaling pathway oaa04921   Oxytocin signaling pathway oaa04971   Gastric acid secretion oaa05014   Amyotrophic lateral sclerosis oaa05100   Bacterial invasion of epithelial cells oaa05132   Salmonella infection oaa05135   Yersinia infection oaa05164   Influenza A oaa05205   Proteoglycans in cancer oaa05225   Hepatocellular carcinoma oaa05410   Hypertrophic cardiomyopathy oaa05412   Arrhythmogenic right ventricular cardiomyopathy oaa05414   Dilated cardiomyopathy oaa05416   Viral myocarditis oaa05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oaa00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100085356 (ACTL8)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100085356 (ACTL8)    04390 Hippo signaling pathway     100085356 (ACTL8)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100085356 (ACTL8)   09143 Cell growth and death    04210 Apoptosis     100085356 (ACTL8)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100085356 (ACTL8)    04520 Adherens junction     100085356 (ACTL8)    04530 Tight junction     100085356 (ACTL8)   09142 Cell motility    04814 Motor proteins     100085356 (ACTL8)    04820 Cytoskeleton in muscle cells     100085356 (ACTL8)    04810 Regulation of actin cytoskeleton     100085356 (ACTL8)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100085356 (ACTL8)    04613 Neutrophil extracellular trap formation     100085356 (ACTL8)    04670 Leukocyte transendothelial migration     100085356 (ACTL8)   09152 Endocrine system    04921 Oxytocin signaling pathway     100085356 (ACTL8)    04919 Thyroid hormone signaling pathway     100085356 (ACTL8)   09154 Digestive system    04971 Gastric acid secretion     100085356 (ACTL8)   09159 Environmental adaptation    04714 Thermogenesis     100085356 (ACTL8)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100085356 (ACTL8)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100085356 (ACTL8)   09172 Infectious disease: viral    05164 Influenza A     100085356 (ACTL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     100085356 (ACTL8)    05135 Yersinia infection     100085356 (ACTL8)    05100 Bacterial invasion of epithelial cells     100085356 (ACTL8)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100085356 (ACTL8)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100085356 (ACTL8)    05410 Hypertrophic cardiomyopathy     100085356 (ACTL8)    05412 Arrhythmogenic right ventricular cardiomyopathy     100085356 (ACTL8)    05414 Dilated cardiomyopathy     100085356 (ACTL8)    05416 Viral myocarditis     100085356 (ACTL8)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:oaa03021]     100085356 (ACTL8)    03019 Messenger RNA biogenesis [BR:oaa03019]     100085356 (ACTL8)    03036 Chromosome and associated proteins [BR:oaa03036]     100085356 (ACTL8)    03029 Mitochondrial biogenesis [BR:oaa03029]     100085356 (ACTL8)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:oaa04812]     100085356 (ACTL8)    04147 Exosome [BR:oaa04147]     100085356 (ACTL8) Transcription machinery [BR:oaa03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      100085356 (ACTL8) Messenger RNA biogenesis [BR:oaa03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100085356 (ACTL8) Chromosome and associated proteins [BR:oaa03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      100085356 (ACTL8)     NuA4 complex      100085356 (ACTL8)   Chromatin remodeling factors    BAF complex     100085356 (ACTL8)    PBAF complex     100085356 (ACTL8)    GBAF(ncBAF) complex     100085356 (ACTL8)    SWR1 complex     100085356 (ACTL8) Mitochondrial biogenesis [BR:oaa03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     100085356 (ACTL8) Cytoskeleton proteins [BR:oaa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      100085356 (ACTL8) Exosome [BR:oaa04147]  Exosomal proteins   Proteins found in most exosomes    100085356 (ACTL8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  100085356 NCBI-ProteinID:  XP_028922134 Ensembl:  ENSOANG00000009183 UniProt:  F7D0M4 LinkDB All DBs Position 5:complement(61536406..61599452) Genome browser AA seq 376 aa AA seqDB search MTTLVIDNGTGLCKAGFAGDNAPKLVVPTAVGIQISPDNMTASGLQNRNILTGWETSRSL LEPGPTLALTFPVTRGVVTDWDEMERLWGYVFQKLHARPTKHPVLLTESPKNRAADRDKL LQIMFETFNVPSTFLGVQGLLALYACGLVTGVVLESGAGATHVVPVHQGFGIPHATLSQE LGGHDLSHFLMKRLLGPMYSFCSLAQRQVIQDIKEDLCYVARDFEMAMRNSARAPSIKTY KLPDGNAISVPEEDRFGCPEALFRPFLLGQGSCGLHHSLFEAVALCDAHLHNSLFSHLVL SGGNTRFCGFLERMKKEMTALAPPTARVQLVNAPGGCFSTWMGGSMLAALSTFQNMWVTR EDYDEMGSLMIQKKSP NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt atgacaaccttggtcatcgacaatgggacggggctgtgcaaggccggttttgcgggggat aatgctcccaaactggtggtgcccacggccgtcggcatccagatctccccagacaacatg acggcctccggcctgcagaacaggaacatactgacgggatgggagacctcccggagcctc ttggagccgggccccactctggccctgaccttccccgttacccggggggtggtcacggac tgggacgagatggagaggctgtggggttacgttttccaaaagctccacgcgaggccgacg aaacaccccgtgctgctcaccgagtcccccaagaacagagcggccgatcgtgataaactg ttgcagatcatgtttgagaccttcaacgtcccgagcacgtttctgggcgttcaggggctg ctggcactctacgcgtgtggcctggtgaccggtgtggtgttggagtctggggcgggcgcc acccacgtggtgcccgtccaccagggcttcggcattccgcacgccaccctgagccaggag ctgggggggcacgacctctcccacttcctcatgaagagactgttgggccccatgtactct ttctgcagcctggcccaaaggcaggtaatccaggacatcaaggaggacctgtgctacgtc gccagagacttcgaaatggccatgcgaaactccgctagggcaccctccatcaagacctac aagctccccgatggcaacgcgatctccgttccggaagaggatcggttcggttgccccgag gctctcttccggcccttcctcctggggcagggctcttgtggtctacaccacagcctcttc gaagctgtagccctgtgtgatgcccacctgcacaactccctcttctcccacctggtgctc tccgggggcaacacccgcttctgcggctttctggagcgcatgaagaaagagatgacggcc ctggccccgcccactgccagagtccagttggttaacgcgccggggggctgcttctctacc tggatgggtgggtccatgctggccgccctgtccaccttccagaacatgtgggtgacccgt gaggactatgatgagatgggatcgttgatgattcagaaaaagtccccgtga

DBGET integrated database retrieval system