Ornithorhynchus anatinus (platypus): 100092821 Help Entry 100092821         CDS       T01045                                  Symbol TP53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa01522   Endocrine resistance oaa01524   Platinum drug resistance oaa04010   MAPK signaling pathway oaa04071   Sphingolipid signaling pathway oaa04110   Cell cycle oaa04115   p53 signaling pathway oaa04137   Mitophagy - animal oaa04151   PI3K-Akt signaling pathway oaa04210   Apoptosis oaa04211   Longevity regulating pathway oaa04216   Ferroptosis oaa04218   Cellular senescence oaa04310   Wnt signaling pathway oaa04722   Neurotrophin signaling pathway oaa04919   Thyroid hormone signaling pathway oaa05012   Parkinson disease oaa05014   Amyotrophic lateral sclerosis oaa05016   Huntington disease oaa05160   Hepatitis C oaa05161   Hepatitis B oaa05162   Measles oaa05163   Human cytomegalovirus infection oaa05165   Human papillomavirus infection oaa05166   Human T-cell leukemia virus 1 infection oaa05167   Kaposi sarcoma-associated herpesvirus infection oaa05168   Herpes simplex virus 1 infection oaa05169   Epstein-Barr virus infection oaa05200   Pathways in cancer oaa05202   Transcriptional misregulation in cancer oaa05203   Viral carcinogenesis oaa05205   Proteoglycans in cancer oaa05206   MicroRNAs in cancer oaa05210   Colorectal cancer oaa05212   Pancreatic cancer oaa05213   Endometrial cancer oaa05214   Glioma oaa05215   Prostate cancer oaa05216   Thyroid cancer oaa05217   Basal cell carcinoma oaa05218   Melanoma oaa05219   Bladder cancer oaa05220   Chronic myeloid leukemia oaa05222   Small cell lung cancer oaa05223   Non-small cell lung cancer oaa05224   Breast cancer oaa05225   Hepatocellular carcinoma oaa05226   Gastric cancer oaa05230   Central carbon metabolism in cancer oaa05417   Lipid and atherosclerosis oaa05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oaa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100092821 (TP53)    04310 Wnt signaling pathway     100092821 (TP53)    04071 Sphingolipid signaling pathway     100092821 (TP53)    04151 PI3K-Akt signaling pathway     100092821 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     100092821 (TP53)   09143 Cell growth and death    04110 Cell cycle     100092821 (TP53)    04210 Apoptosis     100092821 (TP53)    04216 Ferroptosis     100092821 (TP53)    04115 p53 signaling pathway     100092821 (TP53)    04218 Cellular senescence     100092821 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     100092821 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     100092821 (TP53)   09149 Aging    04211 Longevity regulating pathway     100092821 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100092821 (TP53)    05202 Transcriptional misregulation in cancer     100092821 (TP53)    05206 MicroRNAs in cancer     100092821 (TP53)    05205 Proteoglycans in cancer     100092821 (TP53)    05203 Viral carcinogenesis     100092821 (TP53)    05230 Central carbon metabolism in cancer     100092821 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     100092821 (TP53)    05212 Pancreatic cancer     100092821 (TP53)    05225 Hepatocellular carcinoma     100092821 (TP53)    05226 Gastric cancer     100092821 (TP53)    05214 Glioma     100092821 (TP53)    05216 Thyroid cancer     100092821 (TP53)    05220 Chronic myeloid leukemia     100092821 (TP53)    05217 Basal cell carcinoma     100092821 (TP53)    05218 Melanoma     100092821 (TP53)    05219 Bladder cancer     100092821 (TP53)    05215 Prostate cancer     100092821 (TP53)    05213 Endometrial cancer     100092821 (TP53)    05224 Breast cancer     100092821 (TP53)    05222 Small cell lung cancer     100092821 (TP53)    05223 Non-small cell lung cancer     100092821 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100092821 (TP53)    05161 Hepatitis B     100092821 (TP53)    05160 Hepatitis C     100092821 (TP53)    05162 Measles     100092821 (TP53)    05168 Herpes simplex virus 1 infection     100092821 (TP53)    05163 Human cytomegalovirus infection     100092821 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     100092821 (TP53)    05169 Epstein-Barr virus infection     100092821 (TP53)    05165 Human papillomavirus infection     100092821 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     100092821 (TP53)    05014 Amyotrophic lateral sclerosis     100092821 (TP53)    05016 Huntington disease     100092821 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100092821 (TP53)    05418 Fluid shear stress and atherosclerosis     100092821 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100092821 (TP53)    01522 Endocrine resistance     100092821 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:oaa03000]     100092821 (TP53)    03036 Chromosome and associated proteins [BR:oaa03036]     100092821 (TP53)    03400 DNA repair and recombination proteins [BR:oaa03400]     100092821 (TP53) Transcription factors [BR:oaa03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     100092821 (TP53) Chromosome and associated proteins [BR:oaa03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      100092821 (TP53) DNA repair and recombination proteins [BR:oaa03400]  Eukaryotic type   Check point factors    Other check point factors     100092821 (TP53) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  P53 P53_tetramer Motif Other DBs NCBI-GeneID:  100092821 NCBI-ProteinID:  XP_028912140 LinkDB All DBs Position X5:6792241..6798655 Genome browser AA seq 236 aa AA seqDB search MAVYKKTDHRAEVVKRCPHHERSSDGDGAAPAQHLIRVEGNPQATYLNDEKTTRQSVVVP YEPPQVGCEYTTVFYNYMCNSSCMGGMNRRPILTIITLETASGQLLGRQSFEVRVCACPG RDRKSDEENHQKKGESSNPQPPSKEPKRACPSPPKSPVETKKRLLDEEVFTLKIRGRERY EMFRTMNEAFEFKDAKGGQEPEGTRTCRQSLKSKREAPGPRKGKRLLVKEETPESN NT seq 711 nt NT seq  +upstreamnt  +downstreamnt atggccgtctacaagaagaccgaccacagggccgaggtggtgaagaggtgcccccaccac gagcgctcttccgacggtgacggagcggcgcccgcccagcatctgatccgcgtggagggg aacccccaggccacatacttgaatgacgagaagacaacccgtcagagcgtcgtcgtcccc tacgagccacctcaggtgggctgtgagtacaccaccgtgttctacaactacatgtgtaac agctcctgcatggggggaatgaaccgccgacccatcctcaccatcatcacgttggagacg gccagcggtcagctccttggccgtcagagcttcgaggtccgtgtctgcgcctgccccggc cgggaccgcaagtcggacgaggagaatcatcagaagaagggggagtccagcaacccccag cccccttcgaaggaacccaaaagggcctgcccctcgccccccaaaagtcctgttgagacc aagaagaggctgttggatgaagaagtgttcactctgaagatccgtggccgggagcgctac gaaatgtttcgcacaatgaacgaagctttcgagttcaaagatgccaaaggcggacaggaa cctgaggggacacgcacatgccgacagtccctgaaatcgaagagggaggctccaggcccc aggaagggcaaacggctgcttgtcaaagaagagactcccgagtccaactga

DBGET integrated database retrieval system