Ornithorhynchus anatinus (platypus): 114807635 Help Entry 114807635         CDS       T01045                                  Symbol BCL2 Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa01521   EGFR tyrosine kinase inhibitor resistance oaa01522   Endocrine resistance oaa01524   Platinum drug resistance oaa04064   NF-kappa B signaling pathway oaa04066   HIF-1 signaling pathway oaa04071   Sphingolipid signaling pathway oaa04115   p53 signaling pathway oaa04140   Autophagy - animal oaa04141   Protein processing in endoplasmic reticulum oaa04151   PI3K-Akt signaling pathway oaa04210   Apoptosis oaa04215   Apoptosis - multiple species oaa04217   Necroptosis oaa04261   Adrenergic signaling in cardiomyocytes oaa04340   Hedgehog signaling pathway oaa04510   Focal adhesion oaa04621   NOD-like receptor signaling pathway oaa04630   JAK-STAT signaling pathway oaa04722   Neurotrophin signaling pathway oaa04725   Cholinergic synapse oaa04915   Estrogen signaling pathway oaa04928   Parathyroid hormone synthesis, secretion and action oaa04933   AGE-RAGE signaling pathway in diabetic complications oaa05014   Amyotrophic lateral sclerosis oaa05022   Pathways of neurodegeneration - multiple diseases oaa05132   Salmonella infection oaa05145   Toxoplasmosis oaa05152   Tuberculosis oaa05161   Hepatitis B oaa05162   Measles oaa05168   Herpes simplex virus 1 infection oaa05169   Epstein-Barr virus infection oaa05170   Human immunodeficiency virus 1 infection oaa05200   Pathways in cancer oaa05206   MicroRNAs in cancer oaa05207   Chemical carcinogenesis - receptor activation oaa05210   Colorectal cancer oaa05215   Prostate cancer oaa05222   Small cell lung cancer oaa05226   Gastric cancer oaa05417   Lipid and atherosclerosis oaa05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oaa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114807635 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     114807635 (BCL2)    04630 JAK-STAT signaling pathway     114807635 (BCL2)    04064 NF-kappa B signaling pathway     114807635 (BCL2)    04066 HIF-1 signaling pathway     114807635 (BCL2)    04071 Sphingolipid signaling pathway     114807635 (BCL2)    04151 PI3K-Akt signaling pathway     114807635 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     114807635 (BCL2)   09143 Cell growth and death    04210 Apoptosis     114807635 (BCL2)    04215 Apoptosis - multiple species     114807635 (BCL2)    04217 Necroptosis     114807635 (BCL2)    04115 p53 signaling pathway     114807635 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     114807635 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     114807635 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     114807635 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     114807635 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     114807635 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     114807635 (BCL2)    04722 Neurotrophin signaling pathway     114807635 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114807635 (BCL2)    05206 MicroRNAs in cancer     114807635 (BCL2)    05207 Chemical carcinogenesis - receptor activation     114807635 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     114807635 (BCL2)    05226 Gastric cancer     114807635 (BCL2)    05215 Prostate cancer     114807635 (BCL2)    05222 Small cell lung cancer     114807635 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     114807635 (BCL2)    05161 Hepatitis B     114807635 (BCL2)    05162 Measles     114807635 (BCL2)    05168 Herpes simplex virus 1 infection     114807635 (BCL2)    05169 Epstein-Barr virus infection     114807635 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     114807635 (BCL2)    05152 Tuberculosis     114807635 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     114807635 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     114807635 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     114807635 (BCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     114807635 (BCL2)    05418 Fluid shear stress and atherosclerosis     114807635 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     114807635 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     114807635 (BCL2)    01524 Platinum drug resistance     114807635 (BCL2)    01522 Endocrine resistance     114807635 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:oaa01009]     114807635 (BCL2) Protein phosphatases and associated proteins [BR:oaa01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      114807635 (BCL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  114807635 NCBI-ProteinID:  XP_028909790 Ensembl:  ENSOANG00000036446 UniProt:  A0A6I8PQZ7 LinkDB All DBs Position X3:complement(171029..220525) Genome browser AA seq 198 aa AA seqDB search MAQPGTSGDAHRDLVVKFIGYKLAQRGYHWEPSGGSAAPAPAPRLRPPPPAVHLALRRAG DHFSRRYRRDFADMSGQLHLTPSTARARFAAVVDELFRDGVNWGRIVAFFEFGGALCVES VHREMASPVDGIAQWMTDYLGRRLHPWIQEHGGWDAFVELYGEPARPRLDLSWFSLKTLL SLVVVGACITLGAYFGHK NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atggcccagcccgggaccagcggtgacgcccaccgggacctcgtggtcaagttcatcggc tacaagctggcccagcgaggctaccactgggaacccagcggagggtcggcggccccggcc cccgccccccgcctccggccgccgccccccgccgtccacctggccctgcgccgggccggg gaccacttctcccgacgctaccggagggacttcgccgacatgtccggccagctgcacctg accccctccaccgcccgggcccgcttcgccgccgtggtggacgagctcttccgcgacggg gtcaactggggccgcatcgtggccttcttcgagttcgggggggccctgtgcgtggagagc gtccatcgggagatggcctccccggtggacggcatcgcccagtggatgacggactacctc ggccgacggctgcacccctggatccaggagcacggaggctgggacgcctttgtggagctg tacggagagccggcgcggccgaggctggatctctcgtggttttctctcaagaccctgctc agcctggttgtggtgggggcctgcatcaccttgggggcttacttcgggcacaagtga

DBGET integrated database retrieval system