Ovis aries (sheep): 114112830 Help Entry 114112830         CDS       T03117                                  Name (RefSeq) interferon beta-2-like   KO K05415   interferon beta Organism oas  Ovis aries (sheep) Pathway oas04060   Cytokine-cytokine receptor interaction oas04151   PI3K-Akt signaling pathway oas04217   Necroptosis oas04380   Osteoclast differentiation oas04620   Toll-like receptor signaling pathway oas04621   NOD-like receptor signaling pathway oas04622   RIG-I-like receptor signaling pathway oas04623   Cytosolic DNA-sensing pathway oas04630   JAK-STAT signaling pathway oas04650   Natural killer cell mediated cytotoxicity oas04668   TNF signaling pathway oas04936   Alcoholic liver disease oas05135   Yersinia infection oas05142   Chagas disease oas05152   Tuberculosis oas05160   Hepatitis C oas05161   Hepatitis B oas05162   Measles oas05163   Human cytomegalovirus infection oas05164   Influenza A oas05165   Human papillomavirus infection oas05167   Kaposi sarcoma-associated herpesvirus infection oas05168   Herpes simplex virus 1 infection oas05169   Epstein-Barr virus infection oas05170   Human immunodeficiency virus 1 infection oas05171   Coronavirus disease - COVID-19 oas05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     114112830    04668 TNF signaling pathway     114112830    04151 PI3K-Akt signaling pathway     114112830   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114112830  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     114112830  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     114112830    04621 NOD-like receptor signaling pathway     114112830    04622 RIG-I-like receptor signaling pathway     114112830    04623 Cytosolic DNA-sensing pathway     114112830    04650 Natural killer cell mediated cytotoxicity     114112830   09158 Development and regeneration    04380 Osteoclast differentiation     114112830  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     114112830    05161 Hepatitis B     114112830    05160 Hepatitis C     114112830    05171 Coronavirus disease - COVID-19     114112830    05164 Influenza A     114112830    05162 Measles     114112830    05168 Herpes simplex virus 1 infection     114112830    05163 Human cytomegalovirus infection     114112830    05167 Kaposi sarcoma-associated herpesvirus infection     114112830    05169 Epstein-Barr virus infection     114112830    05165 Human papillomavirus infection     114112830   09171 Infectious disease: bacterial    05135 Yersinia infection     114112830    05152 Tuberculosis     114112830   09174 Infectious disease: parasitic    05142 Chagas disease     114112830   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     114112830   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     114112830  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oas04052]     114112830 Cytokines and neuropeptides [BR:oas04052]  Cytokines   Interferons    114112830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Aip3p_Bud6_N Motif Other DBs NCBI-GeneID:  114112830 NCBI-ProteinID:  XP_060266976 LinkDB All DBs Position 2:complement(89668737..89672882) Genome browser AA seq 186 aa AA seqDB search MTYRCLLQMVLLLCLSTTALCRSYSLLRFQQGRSLEVCQNLLWQLPSTPQHCLEFRMDFQ MPEEMKQAQQFRKEDAVLVMYEMLQHIFNILTRDFSSTGWSETIIEHLREELYGQMNRLE PIQKEIMQKQTSTMGDTTDLHLRKYYFNLGQYLKSKEHNRCAWTVVQVQLLRNFSFLKSL TGYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt tgcaggagctacagcttgcttcgattccaacaagggcggagccttgaggtgtgccagaac ctcctgtggcagttaccttcaactcctcaacactgccttgagttcaggatggacttccag atgcctgaggagatgaagcaagcacagcagttccggaaggaagatgccgtattggtcatg tatgagatgctccagcacatcttcaatattctcaccagagacttctccagcactggctgg tctgagaccatcattgagcacctccgtgaggaactctatgggcagatgaatcgtctggag ccaatccagaaggaaataatgcagaagcaaacctccactatgggagacacgaccgatctt cacctgcggaaatattacttcaacctcgggcagtacctcaagtccaaggagcacaacagg tgtgcctggacagtcgtgcaagtgcaattgctcaggaacttttctttcctgaagagccta acaggttacctccgggactga

DBGET integrated database retrieval system