Ovis aries (sheep): 114113232 Help Entry 114113232         CDS       T03117                                  Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism oas  Ovis aries (sheep) Pathway oas04010   MAPK signaling pathway oas04014   Ras signaling pathway oas04015   Rap1 signaling pathway oas04024   cAMP signaling pathway oas04062   Chemokine signaling pathway oas04510   Focal adhesion oas04517   IgSF CAM signaling oas04520   Adherens junction oas04611   Platelet activation oas04670   Leukocyte transendothelial migration oas04720   Long-term potentiation oas04722   Neurotrophin signaling pathway oas04934   Cushing syndrome oas04972   Pancreatic secretion oas05211   Renal cell carcinoma oas05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114113232    04014 Ras signaling pathway     114113232    04015 Rap1 signaling pathway     114113232    04024 cAMP signaling pathway     114113232   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     114113232  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     114113232    04520 Adherens junction     114113232  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     114113232    04670 Leukocyte transendothelial migration     114113232    04062 Chemokine signaling pathway     114113232   09154 Digestive system    04972 Pancreatic secretion     114113232   09156 Nervous system    04720 Long-term potentiation     114113232    04722 Neurotrophin signaling pathway     114113232  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     114113232   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     114113232   09167 Endocrine and metabolic disease    04934 Cushing syndrome     114113232  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oas04147]     114113232    04031 GTP-binding proteins [BR:oas04031]     114113232 Exosome [BR:oas04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114113232   Exosomal proteins of other body fluids (saliva and urine)    114113232   Exosomal proteins of colorectal cancer cells    114113232 GTP-binding proteins [BR:oas04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     114113232 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  114113232 NCBI-ProteinID:  XP_027821069 LinkDB All DBs Position 2:complement(229817080..229819188) Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcgggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat aggaagcaagttgaagtagatgcacagcagtgtatgcttgaaatcttggatactgcagga acggaacaattcacagcaatgagggatttgtacatgaaaaatggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagaacagatt cttcgagttaaagacacggatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcacgacagtggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcgacaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcgtca tgtcagctgctttaa

DBGET integrated database retrieval system