Ovis aries (sheep): 443218 Help Entry 443218            CDS       T03117                                  Symbol FOS Name (RefSeq) protein c-Fos   KO K04379   proto-oncogene protein c-fos Organism oas  Ovis aries (sheep) Pathway oas01522   Endocrine resistance oas04010   MAPK signaling pathway oas04024   cAMP signaling pathway oas04210   Apoptosis oas04380   Osteoclast differentiation oas04620   Toll-like receptor signaling pathway oas04657   IL-17 signaling pathway oas04658   Th1 and Th2 cell differentiation oas04659   Th17 cell differentiation oas04660   T cell receptor signaling pathway oas04662   B cell receptor signaling pathway oas04668   TNF signaling pathway oas04713   Circadian entrainment oas04725   Cholinergic synapse oas04728   Dopaminergic synapse oas04915   Estrogen signaling pathway oas04917   Prolactin signaling pathway oas04921   Oxytocin signaling pathway oas04926   Relaxin signaling pathway oas04928   Parathyroid hormone synthesis, secretion and action oas04932   Non-alcoholic fatty liver disease oas04935   Growth hormone synthesis, secretion and action oas05031   Amphetamine addiction oas05132   Salmonella infection oas05133   Pertussis oas05135   Yersinia infection oas05140   Leishmaniasis oas05142   Chagas disease oas05161   Hepatitis B oas05162   Measles oas05166   Human T-cell leukemia virus 1 infection oas05167   Kaposi sarcoma-associated herpesvirus infection oas05170   Human immunodeficiency virus 1 infection oas05171   Coronavirus disease - COVID-19 oas05200   Pathways in cancer oas05207   Chemical carcinogenesis - receptor activation oas05208   Chemical carcinogenesis - reactive oxygen species oas05210   Colorectal cancer oas05224   Breast cancer oas05231   Choline metabolism in cancer oas05235   PD-L1 expression and PD-1 checkpoint pathway in cancer oas05323   Rheumatoid arthritis oas05417   Lipid and atherosclerosis oas05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     443218 (FOS)    04668 TNF signaling pathway     443218 (FOS)    04024 cAMP signaling pathway     443218 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     443218 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     443218 (FOS)    04660 T cell receptor signaling pathway     443218 (FOS)    04658 Th1 and Th2 cell differentiation     443218 (FOS)    04659 Th17 cell differentiation     443218 (FOS)    04657 IL-17 signaling pathway     443218 (FOS)    04662 B cell receptor signaling pathway     443218 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     443218 (FOS)    04917 Prolactin signaling pathway     443218 (FOS)    04921 Oxytocin signaling pathway     443218 (FOS)    04926 Relaxin signaling pathway     443218 (FOS)    04935 Growth hormone synthesis, secretion and action     443218 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     443218 (FOS)   09156 Nervous system    04725 Cholinergic synapse     443218 (FOS)    04728 Dopaminergic synapse     443218 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     443218 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     443218 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     443218 (FOS)    05207 Chemical carcinogenesis - receptor activation     443218 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     443218 (FOS)    05231 Choline metabolism in cancer     443218 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     443218 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     443218 (FOS)    05224 Breast cancer     443218 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     443218 (FOS)    05170 Human immunodeficiency virus 1 infection     443218 (FOS)    05161 Hepatitis B     443218 (FOS)    05171 Coronavirus disease - COVID-19     443218 (FOS)    05162 Measles     443218 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     443218 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     443218 (FOS)    05135 Yersinia infection     443218 (FOS)    05133 Pertussis     443218 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     443218 (FOS)    05142 Chagas disease     443218 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     443218 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     443218 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     443218 (FOS)    05418 Fluid shear stress and atherosclerosis     443218 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     443218 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     443218 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:oas03000]     443218 (FOS)    04131 Membrane trafficking [BR:oas04131]     443218 (FOS) Transcription factors [BR:oas03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     443218 (FOS) Membrane trafficking [BR:oas04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     443218 (FOS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  443218 NCBI-ProteinID:  NP_001159654 UniProt:  C8BKC1 A0A6P3CXM5 LinkDB All DBs Position 7:84571490..84574889 Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDYCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVMKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT LPLLNDPEPKPSVEPVKSVGSMELKAEPFDDFMFPVSSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc tccccggccggggacagtctctcctactaccattcaccggccgactccttctccagcatg ggttctcccgtcaatgcgcaggactactgcaccgatctggccgtttccagtgccaacttc atcccaacagtgactgccatctcgaccagccctgacctacaatggctagtgcagcccacc ctggtctcctccgtggccccgtcccagaccagagccccccacccctatggagtccctact ccctcagctggggcttactccagggccggagttatgaaaaccatgacgggaggcagagct cagagcattggccggaggggcaaggtagaacagttgtccccagaagaagaagagaaaagg agaatccgaagggaaaggaataagatggctgcagccaaatgccggaaccggaggagagag ctgactgacaccctccaagcggagacagaccaactagaagatgagaagtcggctttgcag acagagattgccaatctgctgaaggagaaggaaaaacttgagttcatcctagcggctcac cgacctgcctgcaagatccctgacgacctgggcttcccagaagagatgtctgtggcttcc cttgatctgagtgggggcctgcctgaggctgccacccctgaatctgaggaggccttcacc ctgcccctcctcaatgaccctgagcccaagccctcagtggagcccgtcaagagtgtcggc agcatggagctgaaggctgagccctttgatgacttcatgttcccagtgtcatccaggccc agcggctcggagaccgcccgctctgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcatggtggctccctggggatggggccaatggccacggagctg gagcccctgtgcaccccagtggtcacctgtactcccagctgcactacttacacgtcttcc ttcgtcttcacctaccccgaggctgactccttccccagctgtgcggctgcccaccgcaag ggcagcagcagcaacgagccttcctctgactcgctcagctcacccacactgctggccctg tga

DBGET integrated database retrieval system