Oreochromis aureus (blue tilapia): 116309228 Help Entry 116309228         CDS       T07295                                  Symbol pole4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism oau  Oreochromis aureus (blue tilapia) Pathway oau03030   DNA replication oau03410   Base excision repair oau03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:oau00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     116309228 (pole4)    03410 Base excision repair     116309228 (pole4)    03420 Nucleotide excision repair     116309228 (pole4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:oau03032]     116309228 (pole4)    03400 DNA repair and recombination proteins [BR:oau03400]     116309228 (pole4) Enzymes [BR:oau01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      116309228 (pole4) DNA replication proteins [BR:oau03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     116309228 (pole4) DNA repair and recombination proteins [BR:oau03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       116309228 (pole4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa Motif Other DBs NCBI-GeneID:  116309228 NCBI-ProteinID:  XP_031581639 Ensembl:  ENSOABG00000008776 LinkDB All DBs Position LG23:42264903..42268246 Genome browser AA seq 128 aa AA seqDB search MAATVTTSLVTATEHDPDRCESEEETRGAEAEDSGQQQTGPVTVSHSRLSKLPLARIKAL MKTDPDVSLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAIDEF AFLEGTLD NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggcagcaacagtgacgacgagtcttgtgaccgcaacggagcacgaccctgaccggtgt gagagtgaggaggagacccgcggggccgaggcggaggacagcggccagcagcagacgggc ccagtcacggtgagccacagccggctgtccaaactcccgctggcccgcatcaaggctctg atgaagaccgacccagacgtgtccctcgccagccaggagtctgtgttcatcatcgctaaa gccacggagttgtttgttgagatgattgccaaagatgctctagtgtatgcacagcaaggg aagaggaaaactttgcaaagaaaagacttggacaatgcaatagaagccatagatgagttt gcatttctcgaaggcacactggattaa

DBGET integrated database retrieval system