Ooceraea biroi (clonal raider ant): 105284276 Help Entry 105284276         CDS       T05778                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism obo  Ooceraea biroi (clonal raider ant) Pathway obo03420   Nucleotide excision repair obo04120   Ubiquitin mediated proteolysis obo04141   Protein processing in endoplasmic reticulum obo04310   Wnt signaling pathway obo04341   Hedgehog signaling pathway - fly obo04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:obo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105284276    04120 Ubiquitin mediated proteolysis     105284276   09124 Replication and repair    03420 Nucleotide excision repair     105284276  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     105284276    04341 Hedgehog signaling pathway - fly     105284276    04350 TGF-beta signaling pathway     105284276  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:obo04121]     105284276    03400 DNA repair and recombination proteins [BR:obo03400]     105284276 Enzymes [BR:obo01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      105284276 Ubiquitin system [BR:obo04121]  Ubiquitin ligases (E3)   UBL E3 ligases    105284276   Multi subunit type E3    SCF complex     Ring finger protein      105284276    Cul2 complex      105284276    Cul3 complex      105284276    Cul4 complex      105284276    Cul7 complex      105284276    Cul8 complex      105284276    Cul9 complex      105284276 DNA repair and recombination proteins [BR:obo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       105284276     TCR (transcription coupled repair) factors      Cul4-CSA complex       105284276 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 PHD_NSD zf-RING_16 Motif Other DBs NCBI-GeneID:  105284276 NCBI-ProteinID:  XP_011345947 LinkDB All DBs Position 12:8350224..8351489 Genome browser AA seq 113 aa AA seqDB search MATTMDVDDDECDLPTSSSGKGEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcgaccaccatggacgtcgacgatgacgagtgtgatttgccgacctccagcagtgga aaaggcgagaagaagcgtttcgaggtgaagaagtggaacgcggtggcattatgggcctgg gatatcgtagtggataattgcgctatctgccgtaaccacattatggacctctgcatcgag tgccaggcaaaccaggcatctgccaccagtgaggaatgcacagtggcctggggagtatgc aaccacgcctttcactttcactgcatctcacgttggctaaaaacacgacaggtttgccca ttggacaatcgcgagtgggaatttcagaaatatggtcattaa

DBGET integrated database retrieval system