Oryza brachyantha (malo sina): 102707436 Help Entry 102707436         CDS       T02995                                  Name (RefSeq) RING-box protein 1A-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism obr  Oryza brachyantha (malo sina) Pathway obr03420   Nucleotide excision repair obr04120   Ubiquitin mediated proteolysis obr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:obr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102707436    04120 Ubiquitin mediated proteolysis     102707436   09124 Replication and repair    03420 Nucleotide excision repair     102707436  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:obr04121]     102707436    03400 DNA repair and recombination proteins [BR:obr03400]     102707436 Enzymes [BR:obr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      102707436 Ubiquitin system [BR:obr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    102707436   Multi subunit type E3    SCF complex     Ring finger protein      102707436    Cul2 complex      102707436    Cul3 complex      102707436    Cul4 complex      102707436    Cul7 complex      102707436    Cul8 complex      102707436    Cul9 complex      102707436 DNA repair and recombination proteins [BR:obr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       102707436     TCR (transcription coupled repair) factors      Cul4-CSA complex       102707436 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-RING_11 DEC-1_N DUF8003 Motif Other DBs NCBI-GeneID:  102707436 NCBI-ProteinID:  XP_006643649 LinkDB All DBs Position 1:300390..303165 Genome browser AA seq 149 aa AA seqDB search MERREPFLSLDLDTRRVDTIDLGSMSAMDTDINAPPPPAPAPAGEGSSAAGPSSSSRKPN KRFEIKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAF HFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggagaggagagagcccttcctctccttggacttggacacgaggagggtagatacgata gatcttggctccatgtcggccatggacaccgacatcaacgcgccgccgccccccgccccc gcccccgccggcgagggctcctccgccgctggtccctcctcctcctcccgcaagcccaac aagcgcttcgagatcaagaagtggaacgccgtcgcgctctgggcctgggatatcgtcgtc gacaactgcgccatctgccgcaaccacatcatggatctctgcatcgagtgccaggcaaac caggccagcgccaccagcgaggagtgcactgtcgcttggggtgtctgtaatcatgctttt cacttccattgcatcagcaggtggctcaagactcgccaagtgtgcccattagacaacagt gaatgggaatttcagaaatatgggcactag

DBGET integrated database retrieval system