Oryza brachyantha (malo sina): 102714616 Help Entry 102714616         CDS       T02995                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism obr  Oryza brachyantha (malo sina) Pathway obr03420   Nucleotide excision repair obr04120   Ubiquitin mediated proteolysis obr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:obr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102714616    04120 Ubiquitin mediated proteolysis     102714616   09124 Replication and repair    03420 Nucleotide excision repair     102714616  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:obr04121]     102714616    03400 DNA repair and recombination proteins [BR:obr03400]     102714616 Enzymes [BR:obr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      102714616 Ubiquitin system [BR:obr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    102714616   Multi subunit type E3    SCF complex     Ring finger protein      102714616    Cul2 complex      102714616    Cul3 complex      102714616    Cul4 complex      102714616    Cul7 complex      102714616    Cul8 complex      102714616    Cul9 complex      102714616 DNA repair and recombination proteins [BR:obr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       102714616     TCR (transcription coupled repair) factors      Cul4-CSA complex       102714616 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  102714616 NCBI-ProteinID:  XP_006647775 UniProt:  J3LGB9 LinkDB All DBs Position 2:22065780..22068551 Genome browser AA seq 114 aa AA seqDB search MDKGDVAVAVPPSAAGASSSGGSKGKRFEIKKWNAVSLWAWDIVVDNCAICRNHIMDLCI ECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggacaagggcgacgtcgccgtggccgtgcccccctccgccgccggggcctcctcctcc gggggaagcaagggcaagcgcttcgagattaagaagtggaacgccgtctccctctgggcc tgggacatcgtcgtggacaactgcgccatctgccgcaaccacatcatggacctctgcatc gagtgccaagcgaaccaggcgagcgccaccagcgaggagtgcaccgtcgcttggggagtt tgcaaccatgcattccacttccactgcatcagccgttggctcaagacccgtcaagtgtgc cctctagacaacagcgagtgggagttccagaagtatggtcactag

DBGET integrated database retrieval system