Ovis canadensis (bighorn sheep): 138432671 Help Entry 138432671         CDS       T11679                                  Name (RefSeq) interferon beta-2-like   KO K05415   interferon beta Organism ocan  Ovis canadensis (bighorn sheep) Pathway ocan04060   Cytokine-cytokine receptor interaction ocan04151   PI3K-Akt signaling pathway ocan04217   Necroptosis ocan04380   Osteoclast differentiation ocan04620   Toll-like receptor signaling pathway ocan04621   NOD-like receptor signaling pathway ocan04622   RIG-I-like receptor signaling pathway ocan04623   Cytosolic DNA-sensing pathway ocan04630   JAK-STAT signaling pathway ocan04650   Natural killer cell mediated cytotoxicity ocan04668   TNF signaling pathway ocan04936   Alcoholic liver disease ocan05135   Yersinia infection ocan05142   Chagas disease ocan05152   Tuberculosis ocan05160   Hepatitis C ocan05161   Hepatitis B ocan05162   Measles ocan05163   Human cytomegalovirus infection ocan05164   Influenza A ocan05165   Human papillomavirus infection ocan05167   Kaposi sarcoma-associated herpesvirus infection ocan05168   Herpes simplex virus 1 infection ocan05169   Epstein-Barr virus infection ocan05170   Human immunodeficiency virus 1 infection ocan05171   Coronavirus disease ocan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocan00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     138432671    04668 TNF signaling pathway     138432671    04151 PI3K-Akt signaling pathway     138432671   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     138432671  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     138432671  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     138432671    04621 NOD-like receptor signaling pathway     138432671    04622 RIG-I-like receptor signaling pathway     138432671    04623 Cytosolic DNA-sensing pathway     138432671    04650 Natural killer cell mediated cytotoxicity     138432671   09158 Development and regeneration    04380 Osteoclast differentiation     138432671  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     138432671    05161 Hepatitis B     138432671    05160 Hepatitis C     138432671    05171 Coronavirus disease     138432671    05164 Influenza A     138432671    05162 Measles     138432671    05168 Herpes simplex virus 1 infection     138432671    05163 Human cytomegalovirus infection     138432671    05167 Kaposi sarcoma-associated herpesvirus infection     138432671    05169 Epstein-Barr virus infection     138432671    05165 Human papillomavirus infection     138432671   09171 Infectious disease: bacterial    05135 Yersinia infection     138432671    05152 Tuberculosis     138432671   09174 Infectious disease: parasitic    05142 Chagas disease     138432671   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     138432671   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     138432671  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocan04052]     138432671 Cytokines and neuropeptides [BR:ocan04052]  Cytokines   Interferons    138432671 SSDB OrthologParalogGFIT Motif Pfam:  Interferon Aip3p_Bud6_N Motif Other DBs NCBI-GeneID:  138432671 NCBI-ProteinID:  XP_069430228 LinkDB All DBs Position 2:complement(90036364..90036924) Genome browser AA seq 186 aa AA seqDB search MTYRCLLQMVLLLCLSTTALSRSYSLLRFQQGRSLEVCQNLLWQLPSTPQHCLEFRMDFQ MPEEMKQAQQFRKEDAVLVMYEMLQHIFNILTRDFSSTGWSETIIEHLREELYGQMNRLE PIQKEIMQKQTSTMGDTTDLHLRKYYFNLGQYLKAKEHNRCAWTVVQVQLLRNFSFLKSL TGYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt tccaggagctacagcttgcttcgattccaacaagggcggagccttgaggtgtgtcagaac ctcctgtggcagttaccttcaactcctcaacattgcctcgagttcaggatggacttccag atgcctgaggagatgaagcaagcacagcagttccggaaggaagatgccgtattggtcatg tatgagatgctccagcacatcttcaatattctcaccagagacttctccagcactggctgg tctgagaccatcattgagcacctccgtgaggaactctatgggcagatgaatcgtctggag ccaatccagaaggaaataatgcagaagcaaacctccactatgggagacacgaccgatctt cacctgcggaaatattacttcaacctcgggcagtacctgaaggccaaggagcacaacagg tgtgcctggacagtcgtgcaagtgcaattgctcaggaacttttctttccttaagagccta acaggttacctccgggactga

DBGET integrated database retrieval system