Oryctolagus cuniculus (rabbit): 100008645 Help Entry 100008645         CDS       T03373                                  Symbol TGFB1 Name (RefSeq) transforming growth factor beta-1   KO K13375   transforming growth factor beta-1 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04010   MAPK signaling pathway ocu04060   Cytokine-cytokine receptor interaction ocu04068   FoxO signaling pathway ocu04110   Cell cycle ocu04218   Cellular senescence ocu04350   TGF-beta signaling pathway ocu04380   Osteoclast differentiation ocu04390   Hippo signaling pathway ocu04659   Th17 cell differentiation ocu04672   Intestinal immune network for IgA production ocu04926   Relaxin signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05144   Malaria ocu05145   Toxoplasmosis ocu05146   Amoebiasis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05166   Human T-cell leukemia virus 1 infection ocu05200   Pathways in cancer ocu05205   Proteoglycans in cancer ocu05210   Colorectal cancer ocu05211   Renal cell carcinoma ocu05212   Pancreatic cancer ocu05220   Chronic myeloid leukemia ocu05225   Hepatocellular carcinoma ocu05226   Gastric cancer ocu05321   Inflammatory bowel disease ocu05323   Rheumatoid arthritis ocu05410   Hypertrophic cardiomyopathy ocu05414   Dilated cardiomyopathy ocu05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100008645 (TGFB1)    04350 TGF-beta signaling pathway     100008645 (TGFB1)    04390 Hippo signaling pathway     100008645 (TGFB1)    04068 FoxO signaling pathway     100008645 (TGFB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100008645 (TGFB1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100008645 (TGFB1)    04218 Cellular senescence     100008645 (TGFB1)  09150 Organismal Systems   09151 Immune system    04659 Th17 cell differentiation     100008645 (TGFB1)    04672 Intestinal immune network for IgA production     100008645 (TGFB1)   09152 Endocrine system    04926 Relaxin signaling pathway     100008645 (TGFB1)   09158 Development and regeneration    04380 Osteoclast differentiation     100008645 (TGFB1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100008645 (TGFB1)    05205 Proteoglycans in cancer     100008645 (TGFB1)   09162 Cancer: specific types    05210 Colorectal cancer     100008645 (TGFB1)    05212 Pancreatic cancer     100008645 (TGFB1)    05225 Hepatocellular carcinoma     100008645 (TGFB1)    05226 Gastric cancer     100008645 (TGFB1)    05220 Chronic myeloid leukemia     100008645 (TGFB1)    05211 Renal cell carcinoma     100008645 (TGFB1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100008645 (TGFB1)    05161 Hepatitis B     100008645 (TGFB1)   09171 Infectious disease: bacterial    05152 Tuberculosis     100008645 (TGFB1)   09174 Infectious disease: parasitic    05146 Amoebiasis     100008645 (TGFB1)    05144 Malaria     100008645 (TGFB1)    05145 Toxoplasmosis     100008645 (TGFB1)    05140 Leishmaniasis     100008645 (TGFB1)    05142 Chagas disease     100008645 (TGFB1)   09163 Immune disease    05323 Rheumatoid arthritis     100008645 (TGFB1)    05321 Inflammatory bowel disease     100008645 (TGFB1)   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     100008645 (TGFB1)    05414 Dilated cardiomyopathy     100008645 (TGFB1)    05415 Diabetic cardiomyopathy     100008645 (TGFB1)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100008645 (TGFB1)    04933 AGE-RAGE signaling pathway in diabetic complications     100008645 (TGFB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ocu03110]     100008645 (TGFB1)   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:ocu04052]     100008645 (TGFB1)    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     100008645 (TGFB1) Chaperones and folding catalysts [BR:ocu03110]  Intramolecular chaperones   Others    100008645 (TGFB1) Cytokines and growth factors [BR:ocu04052]  Cytokines   Transforming growth factors (RSTK binding)    100008645 (TGFB1) Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Growth factors/receptors    100008645 (TGFB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TGFb_propeptide TGF_beta Motif Other DBs NCBI-GeneID:  100008645 NCBI-ProteinID:  XP_008247926 LinkDB All DBs Position Un Genome browser AA seq 392 aa AA seqDB search MPPSGLRLLLPLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLR LASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVDSNN KIYKKYKESRHSVYMLFNTSELREAVPEPVLLSRAELRLQRLKLQQEQHVELYQKYSNDS WRYLSNRLLAPSNTAEWLSFDVTGVVRQWLSHGEEIEGFRLSAHCSCDNKDNVLQVDING ISSGRRGDLATIHSMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQL YIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVP QALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt atgccgccctccgggctacggctgcttctgccgctgctgctgctgccgctgctgtggctc ctagtgttgacgcccggccggccggccgcgggactgtccacctgcaagaccatcgacatg gagctggtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaaactgcgg ctcgccagtcccccgagccagggggaggtgccgcccggtccgcttcccgaggccgtgctc gccctgtacaacagcacccgcgaccgggtggccggggagagcgccgagccggagccggag cccgaggccgactactacgccaaggaggtcacccgcgtgctaatggtggacagcaacaac aaaatctacaaaaaatacaaagaaagccggcatagcgtctatatgctgtttaacacgtca gagctccgggaagcagtgcccgagcccgtgttgctgtccagggcagagctgcgcctgcag aggctcaagttacagcaggagcagcacgtggagctgtaccagaaatacagcaacgattcc tggcgctacctcagcaaccggctgctggccccaagcaacacagcagagtggttgtccttc gatgtcactggagttgtgaggcagtggctgagccacggagaggaaatagagggcttccgc ctcagcgcccactgttcctgtgacaacaaagataatgtcctccaagtggacatcaacggg atcagttccggccgtcgaggtgacctggccaccattcacagcatgaaccgacccttcctg ctcctcatggccacccctctggaacgggctcaacatctacacagttcccggcaccgccga gccctggacaccaactactgcttcagctccacagagaagaactgctgtgtgcggcagctg tacattgacttccgcaaggacctgggctggaagtggatccacgagcccaagggctaccac gccaacttctgcctgggaccctgcccctacatctggagcctggacacccagtacagcaag gtcctggccctgtacaaccagcacaacccgggcgcgtcggcagcgccgtgctgtgtgcca caggcgctggagccactgcccatcgtgtactacgtgggccgcaagcccaaggtggagcag ctgtccaacatgatcgtgcgctcctgcaagtgcagctga

Oryctolagus cuniculus (rabbit): 100352301 Help Entry 100352301         CDS       T03373                                  Name (RefSeq) transforming growth factor beta-1   KO K13375   transforming growth factor beta-1 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04010   MAPK signaling pathway ocu04060   Cytokine-cytokine receptor interaction ocu04068   FoxO signaling pathway ocu04110   Cell cycle ocu04218   Cellular senescence ocu04350   TGF-beta signaling pathway ocu04380   Osteoclast differentiation ocu04390   Hippo signaling pathway ocu04659   Th17 cell differentiation ocu04672   Intestinal immune network for IgA production ocu04926   Relaxin signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05144   Malaria ocu05145   Toxoplasmosis ocu05146   Amoebiasis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05166   Human T-cell leukemia virus 1 infection ocu05200   Pathways in cancer ocu05205   Proteoglycans in cancer ocu05210   Colorectal cancer ocu05211   Renal cell carcinoma ocu05212   Pancreatic cancer ocu05220   Chronic myeloid leukemia ocu05225   Hepatocellular carcinoma ocu05226   Gastric cancer ocu05321   Inflammatory bowel disease ocu05323   Rheumatoid arthritis ocu05410   Hypertrophic cardiomyopathy ocu05414   Dilated cardiomyopathy ocu05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100352301    04350 TGF-beta signaling pathway     100352301    04390 Hippo signaling pathway     100352301    04068 FoxO signaling pathway     100352301   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100352301  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100352301    04218 Cellular senescence     100352301  09150 Organismal Systems   09151 Immune system    04659 Th17 cell differentiation     100352301    04672 Intestinal immune network for IgA production     100352301   09152 Endocrine system    04926 Relaxin signaling pathway     100352301   09158 Development and regeneration    04380 Osteoclast differentiation     100352301  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100352301    05205 Proteoglycans in cancer     100352301   09162 Cancer: specific types    05210 Colorectal cancer     100352301    05212 Pancreatic cancer     100352301    05225 Hepatocellular carcinoma     100352301    05226 Gastric cancer     100352301    05220 Chronic myeloid leukemia     100352301    05211 Renal cell carcinoma     100352301   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100352301    05161 Hepatitis B     100352301   09171 Infectious disease: bacterial    05152 Tuberculosis     100352301   09174 Infectious disease: parasitic    05146 Amoebiasis     100352301    05144 Malaria     100352301    05145 Toxoplasmosis     100352301    05140 Leishmaniasis     100352301    05142 Chagas disease     100352301   09163 Immune disease    05323 Rheumatoid arthritis     100352301    05321 Inflammatory bowel disease     100352301   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     100352301    05414 Dilated cardiomyopathy     100352301    05415 Diabetic cardiomyopathy     100352301   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100352301    04933 AGE-RAGE signaling pathway in diabetic complications     100352301  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ocu03110]     100352301   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:ocu04052]     100352301    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     100352301 Chaperones and folding catalysts [BR:ocu03110]  Intramolecular chaperones   Others    100352301 Cytokines and growth factors [BR:ocu04052]  Cytokines   Transforming growth factors (RSTK binding)    100352301 Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Growth factors/receptors    100352301 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TGFb_propeptide TGF_beta Motif Other DBs NCBI-GeneID:  100352301 NCBI-ProteinID:  XP_017193741 LinkDB All DBs Position Un Genome browser AA seq 376 aa AA seqDB search MAPSGMRLLLPLLWLSVLAPGRPAAEMPGRNATDLELQQRQHLEAFRALLLSKLKTPSPE EEPTIPEPDDVDHSTREQNEEGLELLPRYFRKEVTRVPMLDSNHEIYKKYKDCGHSVYML FNMSELRQAVPEPVLLSRAELRMQVLKLQQEQHVELYQKDSSDSWQYIKSRNLAPSDTDE WLSIVVTRVVRTWLSRGEETEGFRLSTHCSCDSTDDVLQVDINGISSGRRGDLATIHSMN RPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEP KGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKP KVEQLSNMIVRSCKCS NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt atggcgccctccgggatgcgactgctgctgccgctgctgtggctctcagtgttggcgccc ggccgaccggccgcggaaatgcccggccgcaacgccaccgacctggagctgcagcaaagg cagcacctggaggccttccgtgccctgctcctgtccaagctgaagacccccagcccggag gaggaaccaaccattccggagcctgacgacgtggaccacagcacccgcgaacagaacgag gagggccttgagctgttgccccgctacttccgcaaggaggtcacccgcgtgccaatgctg gacagcaaccacgaaatttacaaaaaatacaaagattgcgggcacagcgtctatatgctc ttcaacatgtcagagctccggcaagcagtgcctgagccggtgttgctgtccagggcagag ctgcgcatgcaagtgctcaagttacagcaggagcagcacgtggagctgtaccagaaagac agcagcgattcctggcaatacatcaagagccggaatctggcacccagtgacacagatgag tggttgtccattgttgtcaccagagttgtgcggacgtggctgagccgtggagaggaaaca gagggcttccgcctcagcacccactgctcctgtgacagcacagatgatgtcctccaagtg gacatcaacgggatcagttccggccgtcgaggtgacctggccaccattcacagcatgaac cgacccttcctgctcctcatggccacccctctggaacgggctcaacatctacacagttcc cggcaccgccgagccctggacaccaactactgcttcagctccacagagaagaactgctgt gtgcggcagctgtacattgacttccgcaaggacctgggctggaagtggatccacgagccc aagggctaccacgccaacttctgcctgggaccctgcccctacatctggagcctggacacc cagtacagcaaggtcctggccctgtacaaccagcacaacccgggcgcgtcggcagcgccg tgctgtgtgccacaggcgctggagccactgcccatcgtgtactacgtgggccgcaagccc aaggtggagcagctgtccaacatgatcgtgcgctcctgcaagtgcagctga

Oryctolagus cuniculus (rabbit): 100352552 Help Entry 100352552         CDS       T03373                                  Name (RefSeq) transforming growth factor beta-1   KO K13375   transforming growth factor beta-1 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04010   MAPK signaling pathway ocu04060   Cytokine-cytokine receptor interaction ocu04068   FoxO signaling pathway ocu04110   Cell cycle ocu04218   Cellular senescence ocu04350   TGF-beta signaling pathway ocu04380   Osteoclast differentiation ocu04390   Hippo signaling pathway ocu04659   Th17 cell differentiation ocu04672   Intestinal immune network for IgA production ocu04926   Relaxin signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05144   Malaria ocu05145   Toxoplasmosis ocu05146   Amoebiasis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05166   Human T-cell leukemia virus 1 infection ocu05200   Pathways in cancer ocu05205   Proteoglycans in cancer ocu05210   Colorectal cancer ocu05211   Renal cell carcinoma ocu05212   Pancreatic cancer ocu05220   Chronic myeloid leukemia ocu05225   Hepatocellular carcinoma ocu05226   Gastric cancer ocu05321   Inflammatory bowel disease ocu05323   Rheumatoid arthritis ocu05410   Hypertrophic cardiomyopathy ocu05414   Dilated cardiomyopathy ocu05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100352552    04350 TGF-beta signaling pathway     100352552    04390 Hippo signaling pathway     100352552    04068 FoxO signaling pathway     100352552   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100352552  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100352552    04218 Cellular senescence     100352552  09150 Organismal Systems   09151 Immune system    04659 Th17 cell differentiation     100352552    04672 Intestinal immune network for IgA production     100352552   09152 Endocrine system    04926 Relaxin signaling pathway     100352552   09158 Development and regeneration    04380 Osteoclast differentiation     100352552  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100352552    05205 Proteoglycans in cancer     100352552   09162 Cancer: specific types    05210 Colorectal cancer     100352552    05212 Pancreatic cancer     100352552    05225 Hepatocellular carcinoma     100352552    05226 Gastric cancer     100352552    05220 Chronic myeloid leukemia     100352552    05211 Renal cell carcinoma     100352552   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100352552    05161 Hepatitis B     100352552   09171 Infectious disease: bacterial    05152 Tuberculosis     100352552   09174 Infectious disease: parasitic    05146 Amoebiasis     100352552    05144 Malaria     100352552    05145 Toxoplasmosis     100352552    05140 Leishmaniasis     100352552    05142 Chagas disease     100352552   09163 Immune disease    05323 Rheumatoid arthritis     100352552    05321 Inflammatory bowel disease     100352552   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     100352552    05414 Dilated cardiomyopathy     100352552    05415 Diabetic cardiomyopathy     100352552   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100352552    04933 AGE-RAGE signaling pathway in diabetic complications     100352552  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ocu03110]     100352552   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:ocu04052]     100352552    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     100352552 Chaperones and folding catalysts [BR:ocu03110]  Intramolecular chaperones   Others    100352552 Cytokines and growth factors [BR:ocu04052]  Cytokines   Transforming growth factors (RSTK binding)    100352552 Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Growth factors/receptors    100352552 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TGFb_propeptide Motif Other DBs NCBI-GeneID:  100352552 NCBI-ProteinID:  XP_017193719 LinkDB All DBs Position Un Genome browser AA seq 257 aa AA seqDB search MEASGRQSGQDPWCRAGSPPKGTLGLKVTQLKSVSPTPTWGCLCFFYPCQSSDSSVCSSQ LEIYKKYKDCGHSVYMLFNMSELRQAVPEPVLLSRVELRMQVLKLQQEQHMELYQKDSSD SWQYIKSRNLAPSDTDEWFSIVVTRVVRTWLSRGEEIEGFRLSTHCSCDSTDDVLQLDIN GISSGRRGNHAAAHSMNRPFLLLVATPLKRALKLYGTWDHXALDTNYCFRFLWNSPQTDI SLDGFPVQGRAATALTA NT seq 774 nt NT seq  +upstreamnt  +downstreamnt atggaggcctcaggtagacagagtggtcaggacccatggtgcagggcaggaagcccaccc aaagggaccctgggcctcaaggtcactcagctgaaaagtgtcagtccaactccaacctgg gggtgcctctgcttcttttacccctgccaaagctctgactcctctgtctgctcctcccaa ctagaaatctacaaaaaatacaaagattgtgggcacagcgtctatatgctcttcaacatg tcagagctccggcaagcagtgcccgagccggtgttgctgtcccgggtggagctgcgcatg caagtgctcaagttacagcaggagcagcacatggagctgtaccagaaagacagcagcgat tcctggcaatacatcaagagccggaatctggcacccagtgacacagatgagtggttttcc attgttgtcaccagagttgtgcggacgtggctgagccgtggagaggaaatagagggcttc cgcctcagcacccactgctcctgtgacagcacagatgatgtcctccaactggacatcaac gggatcagttccggccgccgaggtaaccatgccgccgctcatagcatgaaccggcccttc ctgctccttgtggctacccccctaaagagggcactgaaactatatggcacctgggaccac tgagccctggacaccaactactgcttcagattcctgtggaattctccacagacggacatt tctttagacggctttcctgtccagggcagggcggccacggctctgacggcctga

Oryctolagus cuniculus (rabbit): 100352810 Help Entry 100352810         CDS       T03373                                  Name (RefSeq) transforming growth factor beta-1   KO K13375   transforming growth factor beta-1 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04010   MAPK signaling pathway ocu04060   Cytokine-cytokine receptor interaction ocu04068   FoxO signaling pathway ocu04110   Cell cycle ocu04218   Cellular senescence ocu04350   TGF-beta signaling pathway ocu04380   Osteoclast differentiation ocu04390   Hippo signaling pathway ocu04659   Th17 cell differentiation ocu04672   Intestinal immune network for IgA production ocu04926   Relaxin signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05144   Malaria ocu05145   Toxoplasmosis ocu05146   Amoebiasis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05166   Human T-cell leukemia virus 1 infection ocu05200   Pathways in cancer ocu05205   Proteoglycans in cancer ocu05210   Colorectal cancer ocu05211   Renal cell carcinoma ocu05212   Pancreatic cancer ocu05220   Chronic myeloid leukemia ocu05225   Hepatocellular carcinoma ocu05226   Gastric cancer ocu05321   Inflammatory bowel disease ocu05323   Rheumatoid arthritis ocu05410   Hypertrophic cardiomyopathy ocu05414   Dilated cardiomyopathy ocu05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100352810    04350 TGF-beta signaling pathway     100352810    04390 Hippo signaling pathway     100352810    04068 FoxO signaling pathway     100352810   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100352810  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100352810    04218 Cellular senescence     100352810  09150 Organismal Systems   09151 Immune system    04659 Th17 cell differentiation     100352810    04672 Intestinal immune network for IgA production     100352810   09152 Endocrine system    04926 Relaxin signaling pathway     100352810   09158 Development and regeneration    04380 Osteoclast differentiation     100352810  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100352810    05205 Proteoglycans in cancer     100352810   09162 Cancer: specific types    05210 Colorectal cancer     100352810    05212 Pancreatic cancer     100352810    05225 Hepatocellular carcinoma     100352810    05226 Gastric cancer     100352810    05220 Chronic myeloid leukemia     100352810    05211 Renal cell carcinoma     100352810   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100352810    05161 Hepatitis B     100352810   09171 Infectious disease: bacterial    05152 Tuberculosis     100352810   09174 Infectious disease: parasitic    05146 Amoebiasis     100352810    05144 Malaria     100352810    05145 Toxoplasmosis     100352810    05140 Leishmaniasis     100352810    05142 Chagas disease     100352810   09163 Immune disease    05323 Rheumatoid arthritis     100352810    05321 Inflammatory bowel disease     100352810   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     100352810    05414 Dilated cardiomyopathy     100352810    05415 Diabetic cardiomyopathy     100352810   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100352810    04933 AGE-RAGE signaling pathway in diabetic complications     100352810  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ocu03110]     100352810   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:ocu04052]     100352810    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     100352810 Chaperones and folding catalysts [BR:ocu03110]  Intramolecular chaperones   Others    100352810 Cytokines and growth factors [BR:ocu04052]  Cytokines   Transforming growth factors (RSTK binding)    100352810 Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Growth factors/receptors    100352810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TGFb_propeptide Motif Other DBs NCBI-GeneID:  100352810 NCBI-ProteinID:  XP_017193720 LinkDB All DBs Position Un Genome browser AA seq 284 aa AA seqDB search MLPSGMRLLLPLLWLLVLSPARPAVGTLSRNNTHMELLRQQHIQAVGALILAKLGLSSPP SDDEVPTGPVPEDILALYNRTRDQVSGERAKQKPQPDSGFFGKEITSVPMLDSNHEIYQK YKESWHSVYMFFNTSELRHAVPKPVLLSHAELRLQVLKLQQEQHVELYQKCSNDSWRYYR RRKLTPSDTDEWLSFTVTWIVRQWLRGGEEIEGFRLSARRSSDNTDDVLQVDINGISSGR QGDDANTERMTRPFLLLWATPLEREQLLHSAQXRLSLDTNYCFR NT seq 855 nt NT seq  +upstreamnt  +downstreamnt atgctgccctccgggatgcgactgctgctgcctctgctgtggctcctggtgctgtcaccc gcccgcccagccgtgggaacgctcagccgcaacaacacccacatggagctgctcagacaa cagcacatccaggccgtcggcgccctgatcctggccaagctggggctctccagcccccca agtgatgatgaggtgccgacgggtccggtgcccgaggacatactcgccctgtacaacaga acccgcgatcaggtgtccggggagagagctaaacagaagccccaacccgactcaggcttc tttggcaaggagatcaccagtgtgccaatgctggacagcaaccacgaaatctaccaaaaa tacaaagaaagttggcacagcgtctatatgttcttcaacacgtcagagctccggcatgca gtgcccaagccggtgttgctgtcccatgcagagctgcgcctgcaagtgctcaagttacag caggagcagcacgtggagctgtaccagaaatgcagcaacgattcctggcgctactacagg aggcgtaagctgacacccagtgacacagatgagtggttgtcatttaccgtcacctggatt gtgcggcagtggctgagaggtggagaggaaatagagggcttccgcctcagcgcccggagg tccagtgacaacacagatgatgtcctccaagtggacatcaacgggatcagttctggccgc caaggggacgatgccaacactgagagaatgacccggcccttcttgctcctctgggccacc cccctggaacgggagcagctgctacacagcgcccagnctcggctgagcctggacaccaac tactgcttcaggtga

Oryctolagus cuniculus (rabbit): 100353067 Help Entry 100353067         CDS       T03373                                  Name (RefSeq) transforming growth factor beta-1   KO K13375   transforming growth factor beta-1 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04010   MAPK signaling pathway ocu04060   Cytokine-cytokine receptor interaction ocu04068   FoxO signaling pathway ocu04110   Cell cycle ocu04218   Cellular senescence ocu04350   TGF-beta signaling pathway ocu04380   Osteoclast differentiation ocu04390   Hippo signaling pathway ocu04659   Th17 cell differentiation ocu04672   Intestinal immune network for IgA production ocu04926   Relaxin signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05144   Malaria ocu05145   Toxoplasmosis ocu05146   Amoebiasis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05166   Human T-cell leukemia virus 1 infection ocu05200   Pathways in cancer ocu05205   Proteoglycans in cancer ocu05210   Colorectal cancer ocu05211   Renal cell carcinoma ocu05212   Pancreatic cancer ocu05220   Chronic myeloid leukemia ocu05225   Hepatocellular carcinoma ocu05226   Gastric cancer ocu05321   Inflammatory bowel disease ocu05323   Rheumatoid arthritis ocu05410   Hypertrophic cardiomyopathy ocu05414   Dilated cardiomyopathy ocu05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100353067    04350 TGF-beta signaling pathway     100353067    04390 Hippo signaling pathway     100353067    04068 FoxO signaling pathway     100353067   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100353067  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100353067    04218 Cellular senescence     100353067  09150 Organismal Systems   09151 Immune system    04659 Th17 cell differentiation     100353067    04672 Intestinal immune network for IgA production     100353067   09152 Endocrine system    04926 Relaxin signaling pathway     100353067   09158 Development and regeneration    04380 Osteoclast differentiation     100353067  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100353067    05205 Proteoglycans in cancer     100353067   09162 Cancer: specific types    05210 Colorectal cancer     100353067    05212 Pancreatic cancer     100353067    05225 Hepatocellular carcinoma     100353067    05226 Gastric cancer     100353067    05220 Chronic myeloid leukemia     100353067    05211 Renal cell carcinoma     100353067   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100353067    05161 Hepatitis B     100353067   09171 Infectious disease: bacterial    05152 Tuberculosis     100353067   09174 Infectious disease: parasitic    05146 Amoebiasis     100353067    05144 Malaria     100353067    05145 Toxoplasmosis     100353067    05140 Leishmaniasis     100353067    05142 Chagas disease     100353067   09163 Immune disease    05323 Rheumatoid arthritis     100353067    05321 Inflammatory bowel disease     100353067   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     100353067    05414 Dilated cardiomyopathy     100353067    05415 Diabetic cardiomyopathy     100353067   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100353067    04933 AGE-RAGE signaling pathway in diabetic complications     100353067  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ocu03110]     100353067   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:ocu04052]     100353067    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     100353067 Chaperones and folding catalysts [BR:ocu03110]  Intramolecular chaperones   Others    100353067 Cytokines and growth factors [BR:ocu04052]  Cytokines   Transforming growth factors (RSTK binding)    100353067 Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Growth factors/receptors    100353067 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TGFb_propeptide Motif Other DBs NCBI-GeneID:  100353067 NCBI-ProteinID:  XP_008247923 Ensembl:  ENSOCUG00000016689 LinkDB All DBs Position Un Genome browser AA seq 289 aa AA seqDB search MPPSGLRLLLPLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLR LASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVDSNN KIYKKYKESRHSVYMLFNTSELREAVPEPVLLSRAELRLQRLKLQQEQHVELYQKYSNDS WRYLSNRLLAPSNTAEWLSFDVTGVVRQWLSHGEEIEGFRLSTQRSSDSTDDVLQVDING ISSGRQGDDANTERMTRPFLLLWATPLEREQLLHSAQXRLSLDTNYCFR NT seq 870 nt NT seq  +upstreamnt  +downstreamnt atgccgccctccgggctacggctgcttctgccgctgctgctgctgccgctgctgtggctc ctagtgttgacgcccggccggccggccgcgggactgtccacctgcaagaccatcgacatg gagctggtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaaactgcgg ctcgccagtcccccgagccagggggaggtgccgcccggtccgcttcccgaggccgtgctc gccctgtacaacagcacccgcgaccgggtggccggggagagcgccgagccggagccggag cccgaggccgactactacgccaaggaggtcacccgcgtgctaatggtggacagcaacaac aaaatctacaaaaaatacaaagaaagccggcatagcgtctatatgctgtttaacacgtca gagctccgggaagcagtgcccgagcccgtgttgctgtccagggcagagctgcgcctgcag aggctcaagttacagcaggagcagcacgtggagctgtaccagaaatacagcaacgattcc tggcgctacctcagcaaccggctgctggccccaagcaacacagcagagtggttgtccttc gatgtcactggagttgtgcgacagtggctgagccacggagaggaaatagagggcttccgc ctcagcacccagaggtccagtgacagcacagatgatgtcctccaagtggacatcaacggg atcagttctggccgccaaggggacgatgccaacactgagagaatgacccggcccttcttg ctcctctgggccacccccctggaacgggagcagctgctacacagcgcccagnctcggctg agcctggacaccaactactgcttcaggtga

Oryctolagus cuniculus (rabbit): 103345448 Help Entry 103345448         CDS       T03373                                  Name (RefSeq) transforming growth factor beta-1   KO K13375   transforming growth factor beta-1 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04010   MAPK signaling pathway ocu04060   Cytokine-cytokine receptor interaction ocu04068   FoxO signaling pathway ocu04110   Cell cycle ocu04218   Cellular senescence ocu04350   TGF-beta signaling pathway ocu04380   Osteoclast differentiation ocu04390   Hippo signaling pathway ocu04659   Th17 cell differentiation ocu04672   Intestinal immune network for IgA production ocu04926   Relaxin signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05144   Malaria ocu05145   Toxoplasmosis ocu05146   Amoebiasis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05166   Human T-cell leukemia virus 1 infection ocu05200   Pathways in cancer ocu05205   Proteoglycans in cancer ocu05210   Colorectal cancer ocu05211   Renal cell carcinoma ocu05212   Pancreatic cancer ocu05220   Chronic myeloid leukemia ocu05225   Hepatocellular carcinoma ocu05226   Gastric cancer ocu05321   Inflammatory bowel disease ocu05323   Rheumatoid arthritis ocu05410   Hypertrophic cardiomyopathy ocu05414   Dilated cardiomyopathy ocu05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103345448    04350 TGF-beta signaling pathway     103345448    04390 Hippo signaling pathway     103345448    04068 FoxO signaling pathway     103345448   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103345448  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     103345448    04218 Cellular senescence     103345448  09150 Organismal Systems   09151 Immune system    04659 Th17 cell differentiation     103345448    04672 Intestinal immune network for IgA production     103345448   09152 Endocrine system    04926 Relaxin signaling pathway     103345448   09158 Development and regeneration    04380 Osteoclast differentiation     103345448  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103345448    05205 Proteoglycans in cancer     103345448   09162 Cancer: specific types    05210 Colorectal cancer     103345448    05212 Pancreatic cancer     103345448    05225 Hepatocellular carcinoma     103345448    05226 Gastric cancer     103345448    05220 Chronic myeloid leukemia     103345448    05211 Renal cell carcinoma     103345448   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103345448    05161 Hepatitis B     103345448   09171 Infectious disease: bacterial    05152 Tuberculosis     103345448   09174 Infectious disease: parasitic    05146 Amoebiasis     103345448    05144 Malaria     103345448    05145 Toxoplasmosis     103345448    05140 Leishmaniasis     103345448    05142 Chagas disease     103345448   09163 Immune disease    05323 Rheumatoid arthritis     103345448    05321 Inflammatory bowel disease     103345448   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     103345448    05414 Dilated cardiomyopathy     103345448    05415 Diabetic cardiomyopathy     103345448   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     103345448    04933 AGE-RAGE signaling pathway in diabetic complications     103345448  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ocu03110]     103345448   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:ocu04052]     103345448    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     103345448 Chaperones and folding catalysts [BR:ocu03110]  Intramolecular chaperones   Others    103345448 Cytokines and growth factors [BR:ocu04052]  Cytokines   Transforming growth factors (RSTK binding)    103345448 Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Growth factors/receptors    103345448 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TGFb_propeptide Motif Other DBs NCBI-GeneID:  103345448 NCBI-ProteinID:  XP_017193743 LinkDB All DBs Position Un Genome browser AA seq 267 aa AA seqDB search MLPCGMRLLLPLLWLLVLSPARPAAGMPSRNTTEVELLRQQHIEAVHSTIQSPPSEEEVP EDVLTLNSRTHDQGSGESNKQEPKPKLNFSAGKELTGVPMLESDHESYQKFNVSRHSVYM LFNMSELREVMPEPWLLSGAELHLQVLKLQQEQHMELYQKDSNDSWRYLSNRLLAPSNTA EWLSFDVTGVVQQWLSHGGEDEEIEGFRLSARRSSDNTDDVLHVKINGISSSGQGDNANV QKSYRPYLLLIVNPLDRIVPPDPSELI NT seq 804 nt NT seq  +upstreamnt  +downstreamnt atgctgccctgcgggatgcgactgctgctgcctctgctgtggctcctggtgttgtcaccc gcccgcccagccgcaggaatgcccagccgcaacaccaccgaggtggagctgctcagacaa cagcacatcgaggccgttcactccacgatccagagccccccgagcgaggaggaagtgccc gaagacgtgctcaccctgaacagcagaacccatgaccaggggtctggagagagcaataag caagagcccaaacccaagttaaacttctctgcaggcaaggagctcaccggcgtgccaatg ctggagagcgaccacgaaagctatcaaaaattcaacgtaagccggcacagcgtctatatg ctcttcaacatgtcagagctccgggaagtaatgccagagccatggttgctgtctggggca gagctgcacctgcaagtgctcaagttacagcaggagcagcacatggagctgtaccagaaa gacagcaatgattcctggcgctacctcagcaaccggctgctggccccaagcaacacagca gagtggttgtccttcgatgtcactggagttgtgcagcagtggctgagccacggaggtgaa gatgaggaaatagagggcttccgcctcagcgcccggaggtccagtgacaacacagatgat gtcctccatgtgaaaatcaatgggatcagttccagtggccagggtgacaatgccaacgtt cagaaatcctaccggccctatctgctcctcatcgtcaacccactggaccgcattgtgccc ccagacccctcggagctgatctga

Oryctolagus cuniculus (rabbit): 103345451 Help Entry 103345451         CDS       T03373                                  Name (RefSeq) transforming growth factor beta-1   KO K13375   transforming growth factor beta-1 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04010   MAPK signaling pathway ocu04060   Cytokine-cytokine receptor interaction ocu04068   FoxO signaling pathway ocu04110   Cell cycle ocu04218   Cellular senescence ocu04350   TGF-beta signaling pathway ocu04380   Osteoclast differentiation ocu04390   Hippo signaling pathway ocu04659   Th17 cell differentiation ocu04672   Intestinal immune network for IgA production ocu04926   Relaxin signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05144   Malaria ocu05145   Toxoplasmosis ocu05146   Amoebiasis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05166   Human T-cell leukemia virus 1 infection ocu05200   Pathways in cancer ocu05205   Proteoglycans in cancer ocu05210   Colorectal cancer ocu05211   Renal cell carcinoma ocu05212   Pancreatic cancer ocu05220   Chronic myeloid leukemia ocu05225   Hepatocellular carcinoma ocu05226   Gastric cancer ocu05321   Inflammatory bowel disease ocu05323   Rheumatoid arthritis ocu05410   Hypertrophic cardiomyopathy ocu05414   Dilated cardiomyopathy ocu05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103345451    04350 TGF-beta signaling pathway     103345451    04390 Hippo signaling pathway     103345451    04068 FoxO signaling pathway     103345451   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103345451  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     103345451    04218 Cellular senescence     103345451  09150 Organismal Systems   09151 Immune system    04659 Th17 cell differentiation     103345451    04672 Intestinal immune network for IgA production     103345451   09152 Endocrine system    04926 Relaxin signaling pathway     103345451   09158 Development and regeneration    04380 Osteoclast differentiation     103345451  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103345451    05205 Proteoglycans in cancer     103345451   09162 Cancer: specific types    05210 Colorectal cancer     103345451    05212 Pancreatic cancer     103345451    05225 Hepatocellular carcinoma     103345451    05226 Gastric cancer     103345451    05220 Chronic myeloid leukemia     103345451    05211 Renal cell carcinoma     103345451   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103345451    05161 Hepatitis B     103345451   09171 Infectious disease: bacterial    05152 Tuberculosis     103345451   09174 Infectious disease: parasitic    05146 Amoebiasis     103345451    05144 Malaria     103345451    05145 Toxoplasmosis     103345451    05140 Leishmaniasis     103345451    05142 Chagas disease     103345451   09163 Immune disease    05323 Rheumatoid arthritis     103345451    05321 Inflammatory bowel disease     103345451   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     103345451    05414 Dilated cardiomyopathy     103345451    05415 Diabetic cardiomyopathy     103345451   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     103345451    04933 AGE-RAGE signaling pathway in diabetic complications     103345451  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ocu03110]     103345451   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:ocu04052]     103345451    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     103345451 Chaperones and folding catalysts [BR:ocu03110]  Intramolecular chaperones   Others    103345451 Cytokines and growth factors [BR:ocu04052]  Cytokines   Transforming growth factors (RSTK binding)    103345451 Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Growth factors/receptors    103345451 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TGFb_propeptide Motif Other DBs NCBI-GeneID:  103345451 NCBI-ProteinID:  XP_017193717 UniProt:  A0A5F9CDR7 LinkDB All DBs Position Un Genome browser AA seq 203 aa AA seqDB search MSPSPMRRLLLLWLAVLMPGRLAAGTPSCNATDMELPKQQIEAVRAAVLPKVGLSRTLNK REVPPGPVPEDTLVQYNRRHDQVGRKSTEQKPQSQPVFDIFTKFFHMLMVDSNHEIYKTY KESRHSVYMFFNTSELRQVVPEPVMLSQAELHLQVLKIQQEQHVELYQKYNNSWRYLRSW KLTPIDTNDGCPRSHRCAAVAER NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atgtcgccctcccccatgcgacggctgctgctgctgtggctcgcagtgttgatgcccggc cggctggccgcgggaacgcctagctgcaacgccaccgacatggagctgcccaaacagcaa atcgaggcggtccgcgccgcagtcctgcccaaggtggggctgtcccgcaccctgaataag agggaggtgccgcctggtccagtgccagaggacacgctcgtccagtacaacagaagacac gaccaggtgggcaggaagagcaccgagcagaagccacagtcccagccagtgttcgacatc ttcactaagttcttccacatgctaatggtggacagcaaccatgaaatctacaaaacatac aaagaaagccggcacagcgtctatatgttcttcaacacgtcagagctccggcaagtagtg cccgagccggtgatgctgtcccaggcagagctgcacctgcaagtgctcaagatacagcag gagcagcacgtggagctgtaccagaaatacaacaattcctggcgctacctcaggagctgg aagctgacccccatagacaccaatgatggttgtcctcgaagtcacagatgtgcggcagta gctgagaggtga

Oryctolagus cuniculus (rabbit): 103345452 Help Entry 103345452         CDS       T03373                                  Name (RefSeq) transforming growth factor beta-1-like   KO K13375   transforming growth factor beta-1 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04010   MAPK signaling pathway ocu04060   Cytokine-cytokine receptor interaction ocu04068   FoxO signaling pathway ocu04110   Cell cycle ocu04218   Cellular senescence ocu04350   TGF-beta signaling pathway ocu04380   Osteoclast differentiation ocu04390   Hippo signaling pathway ocu04659   Th17 cell differentiation ocu04672   Intestinal immune network for IgA production ocu04926   Relaxin signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05144   Malaria ocu05145   Toxoplasmosis ocu05146   Amoebiasis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05166   Human T-cell leukemia virus 1 infection ocu05200   Pathways in cancer ocu05205   Proteoglycans in cancer ocu05210   Colorectal cancer ocu05211   Renal cell carcinoma ocu05212   Pancreatic cancer ocu05220   Chronic myeloid leukemia ocu05225   Hepatocellular carcinoma ocu05226   Gastric cancer ocu05321   Inflammatory bowel disease ocu05323   Rheumatoid arthritis ocu05410   Hypertrophic cardiomyopathy ocu05414   Dilated cardiomyopathy ocu05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103345452    04350 TGF-beta signaling pathway     103345452    04390 Hippo signaling pathway     103345452    04068 FoxO signaling pathway     103345452   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103345452  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     103345452    04218 Cellular senescence     103345452  09150 Organismal Systems   09151 Immune system    04659 Th17 cell differentiation     103345452    04672 Intestinal immune network for IgA production     103345452   09152 Endocrine system    04926 Relaxin signaling pathway     103345452   09158 Development and regeneration    04380 Osteoclast differentiation     103345452  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103345452    05205 Proteoglycans in cancer     103345452   09162 Cancer: specific types    05210 Colorectal cancer     103345452    05212 Pancreatic cancer     103345452    05225 Hepatocellular carcinoma     103345452    05226 Gastric cancer     103345452    05220 Chronic myeloid leukemia     103345452    05211 Renal cell carcinoma     103345452   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103345452    05161 Hepatitis B     103345452   09171 Infectious disease: bacterial    05152 Tuberculosis     103345452   09174 Infectious disease: parasitic    05146 Amoebiasis     103345452    05144 Malaria     103345452    05145 Toxoplasmosis     103345452    05140 Leishmaniasis     103345452    05142 Chagas disease     103345452   09163 Immune disease    05323 Rheumatoid arthritis     103345452    05321 Inflammatory bowel disease     103345452   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     103345452    05414 Dilated cardiomyopathy     103345452    05415 Diabetic cardiomyopathy     103345452   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     103345452    04933 AGE-RAGE signaling pathway in diabetic complications     103345452  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ocu03110]     103345452   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:ocu04052]     103345452    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     103345452 Chaperones and folding catalysts [BR:ocu03110]  Intramolecular chaperones   Others    103345452 Cytokines and growth factors [BR:ocu04052]  Cytokines   Transforming growth factors (RSTK binding)    103345452 Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Growth factors/receptors    103345452 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TGFb_propeptide Motif Other DBs NCBI-GeneID:  103345452 NCBI-ProteinID:  XP_017193721 LinkDB All DBs Position Un Genome browser AA seq 301 aa AA seqDB search MLPSGMRLLLPLLWLLVLSPARPAVGTLSRNNTHMELLRQQHIQAVGALILAKLGLSSPP SDDEVPTGPVPEDILALYNRTRDQVSGERAKQKPQPDSGFFGKEITSVPMLDSNHEIYQK YKESRHSVYMFFNTSELRQAVPKPVLLSHAELRLQVLKLQQEQQVELYQEEEESNTPCGR RWQHLPLLSPPCFVLQKCSNDSWRYHRRRKLTPSDTDEWLSFTVTWIVRQWLRGGEEIEG FRLSTQRSSDSTDDVLQVDINGISSGRQGDDANTERMTRPFLLLWATPLEREQLLHSAQL G NT seq 906 nt NT seq  +upstreamnt  +downstreamnt atgctgccctccgggatgcgactgctgctgcctctgctgtggctcctggtgctgtcaccc gcccgcccagccgtgggaacgctcagccgcaacaacacccacatggagctgctcagacaa cagcacatccaggccgtcggcgccctgatcctggccaagctggggctctccagcccccca agtgatgatgaggtgccgacgggtccggtgcccgaggacatactcgccctgtacaacaga acccgcgatcaggtgtccggggagagagctaaacagaagccccaacccgactcaggcttc tttggcaaggagatcaccagtgtgccaatgctggacagcaaccacgaaatctaccaaaaa tacaaagaaagtcggcacagcgtctatatgttcttcaacacgtcagagctccggcaagca gtgcccaagccggtgttgctgtcccatgcagagctgcgcctgcaagtgctcaagttacag caggagcagcaggtggagctgtaccaggaggaggaggaatcgaacacgccgtgtgggagg cgctggcagcatctcccgcttctctctcccccgtgctttgtcctccagaaatgcagcaac gattcctggcgctaccacaggaggcgtaagctgacacccagtgacacagatgagtggttg tcatttaccgtcacctggattgtgcggcagtggctgagaggtggagaggaaatagagggc ttccgcctcagcacccagaggtccagtgacagcacagatgatgtcctccaagtggacatc aacgggatcagttctggccgccaaggggacgatgccaacactgagagaatgacccggccc ttcttgctcctctgggccacccccctggaacgggagcagctgctacacagcgcccagctc ggctga

Oryctolagus cuniculus (rabbit): 108175468 Help Entry 108175468         CDS       T03373                                  Name (RefSeq) transforming growth factor beta-1-like   KO K13375   transforming growth factor beta-1 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04010   MAPK signaling pathway ocu04060   Cytokine-cytokine receptor interaction ocu04068   FoxO signaling pathway ocu04110   Cell cycle ocu04218   Cellular senescence ocu04350   TGF-beta signaling pathway ocu04380   Osteoclast differentiation ocu04390   Hippo signaling pathway ocu04659   Th17 cell differentiation ocu04672   Intestinal immune network for IgA production ocu04926   Relaxin signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05144   Malaria ocu05145   Toxoplasmosis ocu05146   Amoebiasis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05166   Human T-cell leukemia virus 1 infection ocu05200   Pathways in cancer ocu05205   Proteoglycans in cancer ocu05210   Colorectal cancer ocu05211   Renal cell carcinoma ocu05212   Pancreatic cancer ocu05220   Chronic myeloid leukemia ocu05225   Hepatocellular carcinoma ocu05226   Gastric cancer ocu05321   Inflammatory bowel disease ocu05323   Rheumatoid arthritis ocu05410   Hypertrophic cardiomyopathy ocu05414   Dilated cardiomyopathy ocu05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108175468    04350 TGF-beta signaling pathway     108175468    04390 Hippo signaling pathway     108175468    04068 FoxO signaling pathway     108175468   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108175468  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     108175468    04218 Cellular senescence     108175468  09150 Organismal Systems   09151 Immune system    04659 Th17 cell differentiation     108175468    04672 Intestinal immune network for IgA production     108175468   09152 Endocrine system    04926 Relaxin signaling pathway     108175468   09158 Development and regeneration    04380 Osteoclast differentiation     108175468  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108175468    05205 Proteoglycans in cancer     108175468   09162 Cancer: specific types    05210 Colorectal cancer     108175468    05212 Pancreatic cancer     108175468    05225 Hepatocellular carcinoma     108175468    05226 Gastric cancer     108175468    05220 Chronic myeloid leukemia     108175468    05211 Renal cell carcinoma     108175468   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108175468    05161 Hepatitis B     108175468   09171 Infectious disease: bacterial    05152 Tuberculosis     108175468   09174 Infectious disease: parasitic    05146 Amoebiasis     108175468    05144 Malaria     108175468    05145 Toxoplasmosis     108175468    05140 Leishmaniasis     108175468    05142 Chagas disease     108175468   09163 Immune disease    05323 Rheumatoid arthritis     108175468    05321 Inflammatory bowel disease     108175468   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     108175468    05414 Dilated cardiomyopathy     108175468    05415 Diabetic cardiomyopathy     108175468   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     108175468    04933 AGE-RAGE signaling pathway in diabetic complications     108175468  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ocu03110]     108175468   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:ocu04052]     108175468    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     108175468 Chaperones and folding catalysts [BR:ocu03110]  Intramolecular chaperones   Others    108175468 Cytokines and growth factors [BR:ocu04052]  Cytokines   Transforming growth factors (RSTK binding)    108175468 Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Growth factors/receptors    108175468 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TGFb_propeptide Motif Other DBs NCBI-GeneID:  108175468 NCBI-ProteinID:  XP_017193718 LinkDB All DBs Position Un Genome browser AA seq 297 aa AA seqDB search MSPSRMRRLLLLWLAVLMPGRLAAGMPSRSATDMKLPKQQIEAVRAPVLPKVGLSRTLNK REVPPGPVPEDTLVQYNRRRDQVGRKSTEQKPQPQPVLDFSAKFFHMLMVDSNHALRLGV TLLLLPLPNPNSSVCSSQLEIYKKYKESRHSVYMFFNTSELRQAVPEPVMLYRAELRLQV LKLQQEQHVELYQKDNNSWRYLRSRKLTPSDTDEWLSFEVTRIVRQWLRGGEEIVGFRLS THCSCDNKNNVLQVDINGITSSRQGEQITIENKHRPYVILMATLPEHTYQLLSAQHG NT seq 894 nt NT seq  +upstreamnt  +downstreamnt atgtcgccctcccgcatgcgacggctgctgctgctgtggctcgcagtgttgatgcccggc cggctggccgcgggaatgcccagccgcagcgccaccgacatgaagctgcccaaacagcaa atcgaggcggtccgtgccccagtcctgcccaaggtggggctgtcccgcaccctgaataag agggaggtgccacccggtccagtgccagaggacacgctcgtccagtacaacagaagacgc gaccaggtgggcaggaagagcaccgagcagaagccccagccccagccggtattggacttc tcagctaagttcttccacatgctaatggtggacagcaaccatgctcttagactgggggtg accctgctccttctaccactgccaaaccccaactcctctgtctgctcctcccaactagaa atctacaaaaaatacaaagaaagccggcacagcgtctatatgttcttcaacacatcagag ctccggcaagcagtgcccgagcccgtgatgctgtaccgggcagagctgcgcctgcaagtg ctcaagttacagcaggagcagcacgtggagctgtaccagaaagacaacaattcctggcgc tacctcaggagccggaagctgacacccagtgacacagatgagtggttgtccttcgaagtc accaggattgtgcggcagtggctgagaggtggagaggaaatagtgggtttccgcctcagc acccactgctcctgtgacaacaaaaataatgtcctccaagtggacatcaacgggatcact tccagccgccaaggtgagcaaatcaccattgagaacaagcaccgcccctacgtgatcctc atggccactttgccagagcacacataccagctactcagcgcccagcacggctga

DBGET integrated database retrieval system