ocu:100352552 : No such data.
ocu:100352810 : No such data.
ocu:100353067 : No such data.
ocu:103345451 : No such data.
ocu:103345452 : No such data.
ocu:108175468 : No such data.

Oryctolagus cuniculus (rabbit): 100008645 Help Entry 100008645         CDS       T03373                                  Symbol TGFB1 Name (RefSeq) transforming growth factor beta-1 proprotein   KO K13375   transforming growth factor beta-1 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04010   MAPK signaling pathway ocu04060   Cytokine-cytokine receptor interaction ocu04068   FoxO signaling pathway ocu04110   Cell cycle ocu04148   Efferocytosis ocu04218   Cellular senescence ocu04350   TGF-beta signaling pathway ocu04380   Osteoclast differentiation ocu04390   Hippo signaling pathway ocu04659   Th17 cell differentiation ocu04672   Intestinal immune network for IgA production ocu04926   Relaxin signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05144   Malaria ocu05145   Toxoplasmosis ocu05146   Amoebiasis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05166   Human T-cell leukemia virus 1 infection ocu05200   Pathways in cancer ocu05205   Proteoglycans in cancer ocu05210   Colorectal cancer ocu05211   Renal cell carcinoma ocu05212   Pancreatic cancer ocu05220   Chronic myeloid leukemia ocu05225   Hepatocellular carcinoma ocu05226   Gastric cancer ocu05321   Inflammatory bowel disease ocu05323   Rheumatoid arthritis ocu05410   Hypertrophic cardiomyopathy ocu05414   Dilated cardiomyopathy ocu05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100008645 (TGFB1)    04350 TGF-beta signaling pathway     100008645 (TGFB1)    04390 Hippo signaling pathway     100008645 (TGFB1)    04068 FoxO signaling pathway     100008645 (TGFB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100008645 (TGFB1)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     100008645 (TGFB1)   09143 Cell growth and death    04110 Cell cycle     100008645 (TGFB1)    04218 Cellular senescence     100008645 (TGFB1)  09150 Organismal Systems   09151 Immune system    04659 Th17 cell differentiation     100008645 (TGFB1)    04672 Intestinal immune network for IgA production     100008645 (TGFB1)   09152 Endocrine system    04926 Relaxin signaling pathway     100008645 (TGFB1)   09158 Development and regeneration    04380 Osteoclast differentiation     100008645 (TGFB1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100008645 (TGFB1)    05205 Proteoglycans in cancer     100008645 (TGFB1)   09162 Cancer: specific types    05210 Colorectal cancer     100008645 (TGFB1)    05212 Pancreatic cancer     100008645 (TGFB1)    05225 Hepatocellular carcinoma     100008645 (TGFB1)    05226 Gastric cancer     100008645 (TGFB1)    05220 Chronic myeloid leukemia     100008645 (TGFB1)    05211 Renal cell carcinoma     100008645 (TGFB1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100008645 (TGFB1)    05161 Hepatitis B     100008645 (TGFB1)   09171 Infectious disease: bacterial    05152 Tuberculosis     100008645 (TGFB1)   09174 Infectious disease: parasitic    05146 Amoebiasis     100008645 (TGFB1)    05144 Malaria     100008645 (TGFB1)    05145 Toxoplasmosis     100008645 (TGFB1)    05140 Leishmaniasis     100008645 (TGFB1)    05142 Chagas disease     100008645 (TGFB1)   09163 Immune disease    05323 Rheumatoid arthritis     100008645 (TGFB1)    05321 Inflammatory bowel disease     100008645 (TGFB1)   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     100008645 (TGFB1)    05414 Dilated cardiomyopathy     100008645 (TGFB1)    05415 Diabetic cardiomyopathy     100008645 (TGFB1)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100008645 (TGFB1)    04933 AGE-RAGE signaling pathway in diabetic complications     100008645 (TGFB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ocu03110]     100008645 (TGFB1)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100008645 (TGFB1)    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     100008645 (TGFB1) Chaperones and folding catalysts [BR:ocu03110]  Intramolecular chaperones   Others    100008645 (TGFB1) Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Transforming growth factors (RSTK binding)    100008645 (TGFB1) Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Growth factors/receptors    100008645 (TGFB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TGFb_propeptide TGF_beta Motif Other DBs NCBI-GeneID:  100008645 NCBI-ProteinID:  XP_051692327 LinkDB All DBs Position Unknown AA seq 387 aa AA seqDB search MLPSGMRLLLPLLWLLVLSPARPAVGTLSRNNTHMELLRQQHIQAVGALILAKLGLSSPP SDDEVPTGPVPEDILALYNRTRDQVSGERAKQKPQPDSGFFGKEITSVPMLDSNHEIYQK YKESRHSVYMFFNTSELRQAVPKPVLLSHAELRLQVLKLQQEQQVELYQKCSNDSWRYHR RRKLTPSDTDEWLSFTVTWIVRQWLRGGEEIEGFRLSAHCSCDNKDNVLQVDINGISSGR RGDLATIHSMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLYIDFR KDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEP LPIVYYVGRKPKVEQLSNMIVRSCKCS NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt atgctgccctccgggatgcgactgctgctgcctctgctgtggctcctggtgctgtcaccc gcccgcccagccgtgggaacgctcagccgcaacaacacccacatggagctgctcagacaa cagcacatccaggccgtcggcgccctgatcctggccaagctggggctctccagcccccca agtgatgatgaggtgccgacgggtccggtgcccgaggacatactcgccctgtacaacaga acccgcgatcaggtgtccggggagagagctaaacagaagccccaacccgactcaggcttc tttggcaaggagatcaccagtgtgccaatgctggacagcaaccacgaaatctaccaaaaa tacaaagaaagtcggcacagcgtctatatgttcttcaacacgtcagagctccggcaagca gtgcccaagccggtgttgctgtcccatgcagagctgcgcctgcaagtgctcaagttacag caggagcagcaggtggagctgtaccagaaatgcagcaacgattcctggcgctaccacagg aggcgtaagctgacacccagtgacacagatgagtggttgtcatttaccgtcacctggatt gtgcggcagtggctgagaggtggagaggaaatagagggcttccgcctcagcgcccactgt tcctgtgacaacaaagataatgtcctccaagtggacatcaacgggatcagttccggccgt cgaggtgacctggccaccattcacagcatgaaccgacccttcctgctcctcatggccacc cctctggaacgggctcaacatctacacagttcccggcaccgccgagccctggacaccaac tactgcttcagctccacagagaagaactgctgtgtgcggcagctgtacattgacttccgc aaggacctgggctggaagtggatccacgagcccaagggctaccacgccaacttctgcctg ggaccctgcccctacatctggagcctggacacccagtacagcaaggtcctggccctgtac aaccagcacaacccgggcgcgtcggcagcgccgtgctgtgtgccacaggcgctggagcca ctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctgtccaacatgatc gtgcgctcctgcaagtgcagctga

Oryctolagus cuniculus (rabbit): 100352301 Help Entry 100352301         CDS       T03373                                  Name (RefSeq) LOW QUALITY PROTEIN: transforming growth factor beta-1 proprotein   KO K13375   transforming growth factor beta-1 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04010   MAPK signaling pathway ocu04060   Cytokine-cytokine receptor interaction ocu04068   FoxO signaling pathway ocu04110   Cell cycle ocu04148   Efferocytosis ocu04218   Cellular senescence ocu04350   TGF-beta signaling pathway ocu04380   Osteoclast differentiation ocu04390   Hippo signaling pathway ocu04659   Th17 cell differentiation ocu04672   Intestinal immune network for IgA production ocu04926   Relaxin signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05144   Malaria ocu05145   Toxoplasmosis ocu05146   Amoebiasis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05166   Human T-cell leukemia virus 1 infection ocu05200   Pathways in cancer ocu05205   Proteoglycans in cancer ocu05210   Colorectal cancer ocu05211   Renal cell carcinoma ocu05212   Pancreatic cancer ocu05220   Chronic myeloid leukemia ocu05225   Hepatocellular carcinoma ocu05226   Gastric cancer ocu05321   Inflammatory bowel disease ocu05323   Rheumatoid arthritis ocu05410   Hypertrophic cardiomyopathy ocu05414   Dilated cardiomyopathy ocu05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100352301    04350 TGF-beta signaling pathway     100352301    04390 Hippo signaling pathway     100352301    04068 FoxO signaling pathway     100352301   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100352301  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     100352301   09143 Cell growth and death    04110 Cell cycle     100352301    04218 Cellular senescence     100352301  09150 Organismal Systems   09151 Immune system    04659 Th17 cell differentiation     100352301    04672 Intestinal immune network for IgA production     100352301   09152 Endocrine system    04926 Relaxin signaling pathway     100352301   09158 Development and regeneration    04380 Osteoclast differentiation     100352301  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100352301    05205 Proteoglycans in cancer     100352301   09162 Cancer: specific types    05210 Colorectal cancer     100352301    05212 Pancreatic cancer     100352301    05225 Hepatocellular carcinoma     100352301    05226 Gastric cancer     100352301    05220 Chronic myeloid leukemia     100352301    05211 Renal cell carcinoma     100352301   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100352301    05161 Hepatitis B     100352301   09171 Infectious disease: bacterial    05152 Tuberculosis     100352301   09174 Infectious disease: parasitic    05146 Amoebiasis     100352301    05144 Malaria     100352301    05145 Toxoplasmosis     100352301    05140 Leishmaniasis     100352301    05142 Chagas disease     100352301   09163 Immune disease    05323 Rheumatoid arthritis     100352301    05321 Inflammatory bowel disease     100352301   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     100352301    05414 Dilated cardiomyopathy     100352301    05415 Diabetic cardiomyopathy     100352301   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100352301    04933 AGE-RAGE signaling pathway in diabetic complications     100352301  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ocu03110]     100352301   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100352301    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     100352301 Chaperones and folding catalysts [BR:ocu03110]  Intramolecular chaperones   Others    100352301 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Transforming growth factors (RSTK binding)    100352301 Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Growth factors/receptors    100352301 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TGFb_propeptide Motif Other DBs NCBI-GeneID:  100352301 NCBI-ProteinID:  XP_051692408 Ensembl:  ENSOCUG00000030402 LinkDB All DBs Position Unknown AA seq 273 aa AA seqDB search MAPSGMRLLLPLLWLSVLAPGRPAAEMPGRNATDLELQQRQHLEAFRALLLSKLKTPSPE EEPTIPEPDDVDHSTREQNEEGLELLPRYFRKEVTRVPMLDSNHEIYKKYKDCGHSVYML FNMSELRQAVPEPVLLSRAELRMQVLKLQQEQHVELYQKDSSDSWQYIKSRNLAPSDTDE WLSIVVTRVVRTWLSRGEETEGFRLSTHCSCDSTDDVLQVDINGISSGRRGNHAAAHSMN RPFLLLVATPLERALQLNGAWHHXALDTNYCFR NT seq 822 nt NT seq  +upstreamnt  +downstreamnt atggcgccctccgggatgcgactgctgctgccgctgctgtggctctcagtgttggcgccc ggccgcccggccgcggaaatgcccggccgcaacgccaccgacctggagctgcagcaaagg cagcacctggaggccttccgtgccctgctcctgtccaagctgaagacccccagcccggag gaggaaccaaccattccggagcctgacgacgtggaccacagcacccgcgaacagaacgag gagggccttgagctgttgccccgctacttccgcaaggaggtcacccgcgtgccaatgctg gacagcaaccacgaaatttacaaaaaatacaaagattgcgggcacagcgtctatatgctc ttcaacatgtcagagctccggcaagcagtgcctgagccggtgttgctgtccagggcagag ctgcgcatgcaagtgctcaagttacagcaggagcagcacgtggagctgtaccagaaagac agcagcgattcctggcaatacatcaagagccggaatctggcacccagtgacacagatgag tggttgtccattgttgtcaccagagttgtgcggacgtggctgagccgtggagaggaaaca gagggcttccgcctcagcacccactgctcctgtgacagcacagatgatgtcctccaagtg gacatcaacgggatcagttccggccgccgaggtaaccatgccgccgctcatagcatgaac cggcccttcctgctccttgtggctactcccctagagagggcactgcagctaaatggcgcc tggcaccactgagccctggacaccaactactgcttcaggtga

Oryctolagus cuniculus (rabbit): 103345448 Help Entry 103345448         CDS       T03373                                  Name (RefSeq) transforming growth factor beta-1 proprotein isoform X9   KO K13375   transforming growth factor beta-1 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04010   MAPK signaling pathway ocu04060   Cytokine-cytokine receptor interaction ocu04068   FoxO signaling pathway ocu04110   Cell cycle ocu04148   Efferocytosis ocu04218   Cellular senescence ocu04350   TGF-beta signaling pathway ocu04380   Osteoclast differentiation ocu04390   Hippo signaling pathway ocu04659   Th17 cell differentiation ocu04672   Intestinal immune network for IgA production ocu04926   Relaxin signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05144   Malaria ocu05145   Toxoplasmosis ocu05146   Amoebiasis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05166   Human T-cell leukemia virus 1 infection ocu05200   Pathways in cancer ocu05205   Proteoglycans in cancer ocu05210   Colorectal cancer ocu05211   Renal cell carcinoma ocu05212   Pancreatic cancer ocu05220   Chronic myeloid leukemia ocu05225   Hepatocellular carcinoma ocu05226   Gastric cancer ocu05321   Inflammatory bowel disease ocu05323   Rheumatoid arthritis ocu05410   Hypertrophic cardiomyopathy ocu05414   Dilated cardiomyopathy ocu05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103345448    04350 TGF-beta signaling pathway     103345448    04390 Hippo signaling pathway     103345448    04068 FoxO signaling pathway     103345448   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103345448  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     103345448   09143 Cell growth and death    04110 Cell cycle     103345448    04218 Cellular senescence     103345448  09150 Organismal Systems   09151 Immune system    04659 Th17 cell differentiation     103345448    04672 Intestinal immune network for IgA production     103345448   09152 Endocrine system    04926 Relaxin signaling pathway     103345448   09158 Development and regeneration    04380 Osteoclast differentiation     103345448  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103345448    05205 Proteoglycans in cancer     103345448   09162 Cancer: specific types    05210 Colorectal cancer     103345448    05212 Pancreatic cancer     103345448    05225 Hepatocellular carcinoma     103345448    05226 Gastric cancer     103345448    05220 Chronic myeloid leukemia     103345448    05211 Renal cell carcinoma     103345448   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103345448    05161 Hepatitis B     103345448   09171 Infectious disease: bacterial    05152 Tuberculosis     103345448   09174 Infectious disease: parasitic    05146 Amoebiasis     103345448    05144 Malaria     103345448    05145 Toxoplasmosis     103345448    05140 Leishmaniasis     103345448    05142 Chagas disease     103345448   09163 Immune disease    05323 Rheumatoid arthritis     103345448    05321 Inflammatory bowel disease     103345448   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     103345448    05414 Dilated cardiomyopathy     103345448    05415 Diabetic cardiomyopathy     103345448   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     103345448    04933 AGE-RAGE signaling pathway in diabetic complications     103345448  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ocu03110]     103345448   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     103345448    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     103345448 Chaperones and folding catalysts [BR:ocu03110]  Intramolecular chaperones   Others    103345448 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Transforming growth factors (RSTK binding)    103345448 Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Growth factors/receptors    103345448 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TGFb_propeptide Motif Other DBs NCBI-GeneID:  103345448 NCBI-ProteinID:  XP_017193743 LinkDB All DBs Position Unknown AA seq 267 aa AA seqDB search MLPCGMRLLLPLLWLLVLSPARPAAGMPSRNTTEVELLRQQHIEAVHSTIQSPPSEEEVP EDVLTLNSRTHDQGSGESNKQEPKPKLNFSAGKELTGVPMLESDHESYQKFNVSRHSVYM LFNMSELREVMPEPWLLSGAELHLQVLKLQQEQHMELYQKDSNDSWRYLSNRLLAPSNTA EWLSFDVTGVVQQWLSHGGEDEEIEGFRLSARRSSDNTDDVLHVKINGISSSGQGDNANV QKSYRPYLLLIVNPLDRIVPPDPSELI NT seq 804 nt NT seq  +upstreamnt  +downstreamnt atgctgccctgcgggatgcgactgctgctgcctctgctgtggctcctggtgttgtcaccc gcccgcccagccgcaggaatgcccagccgcaacaccaccgaggtggagctgctcagacaa cagcacatcgaggccgttcactccacgatccagagccccccgagcgaggaggaagtgccc gaagacgtgctcaccctgaacagcagaacccatgaccaggggtctggagagagcaataag caagagcccaaacccaagttaaacttctctgcaggcaaggagctcaccggcgtgccaatg ctggagagcgaccacgaaagctatcaaaaattcaacgtaagccggcacagcgtctatatg ctcttcaacatgtcagagctccgggaagtaatgccagagccatggttgctgtctggggca gagctgcacctgcaagtgctcaagttacagcaggagcagcacatggagctgtaccagaaa gacagcaatgattcctggcgctacctcagcaaccggctgctggccccaagcaacacagca gagtggttgtccttcgatgtcactggagttgtgcagcagtggctgagccacggaggtgaa gatgaggaaatagagggcttccgcctcagcgcccggaggtccagtgacaacacagatgat gtcctccatgtgaaaatcaatgggatcagttccagtggccagggtgacaatgccaacgtt cagaaatcctaccggccctatctgctcctcatcgtcaacccactggaccgcattgtgccc ccagacccctcggagctgatctga