Oryctolagus cuniculus (rabbit): 100008733 Help Entry 100008733         CDS       T03373                                  Symbol IL6 Name (RefSeq) interleukin-6 precursor   KO K05405   interleukin 6 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01521   EGFR tyrosine kinase inhibitor resistance ocu01523   Antifolate resistance ocu04060   Cytokine-cytokine receptor interaction ocu04061   Viral protein interaction with cytokine and cytokine receptor ocu04066   HIF-1 signaling pathway ocu04068   FoxO signaling pathway ocu04151   PI3K-Akt signaling pathway ocu04218   Cellular senescence ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04623   Cytosolic DNA-sensing pathway ocu04625   C-type lectin receptor signaling pathway ocu04630   JAK-STAT signaling pathway ocu04640   Hematopoietic cell lineage ocu04657   IL-17 signaling pathway ocu04659   Th17 cell differentiation ocu04668   TNF signaling pathway ocu04672   Intestinal immune network for IgA production ocu04931   Insulin resistance ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04936   Alcoholic liver disease ocu05010   Alzheimer disease ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05133   Pertussis ocu05134   Legionellosis ocu05135   Yersinia infection ocu05142   Chagas disease ocu05143   African trypanosomiasis ocu05144   Malaria ocu05146   Amoebiasis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05202   Transcriptional misregulation in cancer ocu05321   Inflammatory bowel disease ocu05323   Rheumatoid arthritis ocu05332   Graft-versus-host disease ocu05410   Hypertrophic cardiomyopathy ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100008733 (IL6)    04668 TNF signaling pathway     100008733 (IL6)    04066 HIF-1 signaling pathway     100008733 (IL6)    04068 FoxO signaling pathway     100008733 (IL6)    04151 PI3K-Akt signaling pathway     100008733 (IL6)   09133 Signaling molecules and interaction    04061 Viral protein interaction with cytokine and cytokine receptor     100008733 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100008733 (IL6)    04620 Toll-like receptor signaling pathway     100008733 (IL6)    04659 Th17 cell differentiation     100008733 (IL6)    04657 IL-17 signaling pathway     100008733 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100008733 (IL6)    05202 Transcriptional misregulation in cancer     100008733 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100008733 (IL6)    05161 Hepatitis B     100008733 (IL6)    05171 Coronavirus disease - COVID-19     100008733 (IL6)    05164 Influenza A     100008733 (IL6)    05162 Measles     100008733 (IL6)    05163 Human cytomegalovirus infection     100008733 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     100008733 (IL6)    05169 Epstein-Barr virus infection     100008733 (IL6)   09171 Infectious disease: bacterial    05135 Yersinia infection     100008733 (IL6)    05133 Pertussis     100008733 (IL6)    05134 Legionellosis     100008733 (IL6)    05152 Tuberculosis     100008733 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     100008733 (IL6)    05144 Malaria     100008733 (IL6)    05142 Chagas disease     100008733 (IL6)    05143 African trypanosomiasis     100008733 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     100008733 (IL6)    05321 Inflammatory bowel disease     100008733 (IL6)    05332 Graft-versus-host disease     100008733 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     100008733 (IL6)    05020 Prion disease     100008733 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     100008733 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100008733 (IL6)    05410 Hypertrophic cardiomyopathy     100008733 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100008733 (IL6)    04932 Non-alcoholic fatty liver disease     100008733 (IL6)    04931 Insulin resistance     100008733 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     100008733 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100008733 (IL6)    01523 Antifolate resistance     100008733 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100008733 (IL6) Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Interleukins    100008733 (IL6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL6 IL23 DUF641 Cas_St_Csn2 UPF0147 ARTD15_N Motif Other DBs NCBI-GeneID:  100008733 NCBI-ProteinID:  NP_001075533 Ensembl:  ENSOCUG00000027471 UniProt:  Q9MZR1 LinkDB All DBs Position 10:4825832..4830644 Genome browser AA seq 241 aa AA seqDB search MNSFTSALRPGPLGCSLALLLVVATAFPTSAPVREDSNTKASPDKTLTPPGRTIESIRSI LETIKELRKEMCDHDVNCMNRKEALAEVNLHLPRLIEEDGCFPPAVNNETCLLRITSGLM EFRMYLEHLQAKFRSDEENTRVSMVLKNIQHLIKTLRPKVKNLNEEATLKPAVAVSLMEN LQQKNQWLKTTTIHFILRGLTNFLEFTLRAVDLMECGCPCLRNFMGSASHGQNTPSCPLD T NT seq 726 nt NT seq  +upstreamnt  +downstreamnt atgaactccttcacaagcgccctccgcccaggtcccctcggctgctcgctggcgctgctc ctggtggtggctaccgctttccccacttcagcacccgtgagggaggactccaacaccaag gccagccccgacaaaaccctcacgccgccaggcagaaccatcgagagcatccggagcatc ctggagaccatcaaggagctgaggaaagagatgtgtgaccatgatgtcaactgcatgaac agaaaggaggcactggcggaagtcaatctgcaccttccaaggctgatagaagaagacgga tgcttcccgccggcggtgaataatgagacctgcctgctgagaatcacttcggggctgatg gagttccggatgtatctcgagcaccttcaggccaagttcaggagtgacgaagaaaacacc agggtcagcatggtgctgaagaacatccaacacctgatcaagaccctgaggccaaaggtc aagaatttgaatgaagaagccaccctcaagccagccgttgcggtcagcctgatggagaac ctgcagcagaaaaaccagtggctgaagacgaccacgatccacttcatcctgcgcggcctc acaaacttcctggagttcaccctgcgtgccgtggacctgatggagtgcgggtgtccttgc ttgcggaatttcatgggctctgcctcccacggtcagaacacaccatcctgtccattggac acataa

DBGET integrated database retrieval system